(data stored in ACNUC7421 zone)

EMBL: CP000431.PE197

CP000431.PE197       Location/Qualifiers
FT   CDS_pept        complement(253283..254422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00197"
FT                   /product="probable sigma factor, includes region 2"
FT                   /note="GO_component: GO:0005634 - nucleus; GO_function:
FT                   GO:0003700 - transcription factor activity; GO_function:
FT                   GO:0003899 - DNA-directed RNA polymerase activity;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_function:
FT                   GO:0016987 - sigma factor activity; GO_process: GO:0006352
FT                   - transcription initiation; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0006457 - protein folding; GO_process: GO:0006606 -
FT                   protein import into nucleus; GO_process: GO:0006986 -
FT                   response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92033"
FT                   /db_xref="GOA:Q0SKA3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA3"
FT                   /protein_id="ABG92033.1"
FT                   /translation="MLAPRRRAVDRCSRTGVGPTTGGRAESFLVTDMSARTPDAAAADA
FT                   EAADLARARDGDDAAFTRLVGPLRRELHAHCYRMLGSSHDADDALQDALLRAWRGFARF
FT                   EGRSTLRSWLYTVATRTCLDAVESRGRRALPVDLGPSSDRAVIGDVPLTDVAWLGPYAD
FT                   AGLTAGSAGPAARYEQREAVELAFVAALQHLPGNQRAALLLFEVLGFSAAEIADTMNTS
FT                   TASVNSALQRARTIVAEKIPPVTQAHTVREIDDARLRAIVAGYSTALERGDADALVALL
FT                   TEDVTWSMPPMAHWYRGLDAVTDFAVRVPLTGCGSWRHLPVGANGQPAVAFYLWDEDAG
FT                   THLRWSITVLTLRGTKIADLTSFLGPEHFDPFGLPESLP"
     gtgctcgcgc cccgccgcag agcggtggac cggtgttcgc gaacaggagt gggtccgacc        60
     accggcggtc gggcagaatc gtttcttgtg accgacatgt ccgcacgaac ccccgacgcg       120
     gcggcggcag acgccgaggc tgccgacctg gcgcgggccc gcgacggaga cgacgccgcg       180
     ttcacccgcc tggtcggacc gttgcgccgc gaactgcacg cccactgcta ccgcatgctc       240
     ggctccagtc acgacgccga cgacgcgctg caggatgccc tgctgcgggc gtggcggggt       300
     ttcgcgcggt tcgaaggtcg gagcacgctg cgctcctggc tgtacaccgt cgcgacgcgc       360
     acgtgcctgg acgctgtcga atcgcgcggt aggcgggcgc tgcccgtcga cctgggtccg       420
     tccagtgatc gtgctgtcat cggtgacgtc ccgctcacgg acgtggcgtg gctggggccg       480
     tacgccgacg cgggtctgac cgccggttca gcggggccgg ccgcacgcta cgagcaacgt       540
     gaggccgtcg aattggcatt cgttgcggca ctgcaacatc tgccgggcaa tcagcgtgcg       600
     gccctgcttc tcttcgaagt cctgggtttc tccgccgccg agatcgccga caccatgaac       660
     acgtcgacgg cgtcggtgaa cagcgcgctg cagcgggcac gcacgatcgt cgccgagaaa       720
     attccgccgg tgacgcaggc gcacactgtg cgagagatcg acgacgcgcg tctgcgtgcc       780
     atcgtcgccg ggtactccac tgctttggaa cgcggtgatg ccgacgccct ggttgccctg       840
     ctgacggagg atgtcacctg gtcgatgccg ccgatggcgc actggtaccg cggtctcgac       900
     gcggtcaccg atttcgcggt ccgggtcccg ctcacggggt gcggttcgtg gcgtcacctc       960
     ccggtcggtg cgaacggtca gcccgccgtc gccttctacc tgtgggacga ggacgccggc      1020
     acccacctgc gctggtcgat caccgtgctg accctgcgcg gcaccaagat cgcggacctg      1080
     acctcgttcc tcgggccgga gcatttcgac cccttcgggt tgcccgaatc gctgccctga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page