(data stored in ACNUC7421 zone)

EMBL: CP000431.PE2

CP000431.PE2         Location/Qualifiers
FT   CDS_pept        3556..4122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91838"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S090"
FT                   /protein_id="ABG91838.1"
FT                   /translation="MPTVAAHCTLHLVSGPEPPPPSSWSIGTRPDWPSPVSSSPPAASG
FT                   SGGDPRSAARTERVGPERPHRRAACDPPLPPADREEPQCRHPNLTTRRPDDQTIVSLNA
FT                   VRQRTTDDLLSGHVPLTSLLYRRRDRIAADLLVSDVLTTYMRGHGIGPAGVMVMLGIAD
FT                   DARARDPTAEQRGQITDAIAATSER"
     atgcccaccg tggccgcgca ctgcaccctc cacctcgtct ccggccccga accaccccca        60
     ccgtcttcgt ggtcgattgg cacgcgaccg gactggccct cgccggtgtc gtcctcgccg       120
     ccggcggcgt ctggctccgg tggcgatccc cgctccgcag cacggaccga acgagttggg       180
     ccggagcgac cgcaccgccg cgctgcctgt gatccgccgt tgccgcctgc cgaccgagag       240
     gaaccccagt gccgacaccc aaacctgacg accagacgac cagacgacca gacgatcgtc       300
     agtctgaacg cggtgcgtca gaggacaacc gacgacctac tgtccgggca cgtaccactg       360
     acgtcgctgc tgtaccgccg acgcgaccga atcgccgccg acctactcgt ctccgacgtc       420
     ctcaccacat acatgcgcgg tcacgggatc gggccggccg gggtcatggt catgctcggc       480
     atcgccgacg acgcccgggc ccgcgacccg accgccgaac agcgcgggca gatcaccgac       540
     gcgatcgccg cgacgagcga gcgatag                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page