(data stored in ACNUC7421 zone)

EMBL: CP000431.PE20

CP000431.PE20        Location/Qualifiers
FT   CDS_pept        complement(27656..27904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91856"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT0"
FT                   /protein_id="ABG91856.1"
FT                   /translation="MLVPNFCLDLHRCRPRMTPVGEKVTNPRSAPGPIDSVTAASRPGD
FT                   QRLCRRGPAVTTLRRGARSKVARVPISPTPAAEGMRP"
     ttgctggtgc cgaatttctg cctcgacctt catcgttgcc gcccccgaat gacacccgta        60
     ggggagaagg tcaccaaccc gaggtcggca cccggcccga ttgactccgt gaccgcggca       120
     tcccgcccgg gtgaccaacg gctctgtcgc cgcggacctg cagtgacgac actgagacga       180
     ggcgcccgat cgaaagttgc ccgagttccg atatcaccga cgccggctgc ggaaggaatg       240
     cgaccatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page