(data stored in ACNUC7421 zone)

EMBL: CP000431.PE203

CP000431.PE203       Location/Qualifiers
FT   CDS_pept        258190..258903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK97"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92039.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKMLASSPEFAKISDSVREELINAAKAAAVTAASQRINSLNNRLLSSGGEAVGDV
FT                   GDTVDDTVSGVGNSVGKLSRVGKLGRKRRGRSQDDEYDESEVDEEQDEQPDEQYAEEDD
FT                   EYEEPEEEEAAEEEPAPRKRPAARRRTSSSGSSRPAGRSRTAKSDLDDEEAPTRGRKTR
FT                   AKATTDSAPVRRARR"
     atgaaaacca aaggtcaggt ggcattggcc gtcggtgcgg gatacatgct gggccgtaca        60
     caccgaatga aaatggcact gatgctcgcg gccgcgggtg cgaccggacg cttccccggc       120
     gggccacgcg acttactgga acgcgggacg aaaatgctcg cgagctcccc cgagttcgcc       180
     aagatcagcg actcggtacg cgaggagctg atcaacgcgg caaaggccgc agcggtcacg       240
     gccgcaagcc agcgcatcaa ttctctcaac aaccggctcc tgtcgagcgg cggagaagcc       300
     gtcggcgacg tgggcgacac cgtggacgac acggtgagcg gtgtcggcaa ctccgtaggc       360
     aagctcagca gggtcggaaa actcggccgt aaacgacgcg gccggtcgca ggacgacgag       420
     tacgacgagt ccgaagtcga cgaagagcag gacgaacagc ccgacgaaca gtacgccgaa       480
     gaggacgacg agtacgagga gcccgaggag gaagaagccg ccgaggagga acccgcccct       540
     cgcaagcgcc ccgccgcgcg tcgacggact tccagcagcg gtagctcccg gccggcaggc       600
     aggtcgcgga ccgcgaaatc cgacttggat gacgaagaag ctcccacgcg cggccgcaag       660
     acgcgggcca aagccaccac tgattcagcg cccgtccgac gggcacggag gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page