(data stored in ACNUC7421 zone)

EMBL: CP000431.PE204

CP000431.PE204       Location/Qualifiers
FT   CDS_pept        258909..260090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00204"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016218 - polyketide synthase
FT                   activity; GO_process: GO:0017000 - antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92040"
FT                   /db_xref="GOA:Q0SK96"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK96"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92040.1"
FT                   /translation="MTSAAKKLREAAPGDGDGSSSVLQEAMQRLVGTVAEKALSSVSDK
FT                   VANTSGRLTEYAENGGEGGLLAALTGSEKSDDDESPDESDTGGGWWEGAKQTVKDKASD
FT                   LKDAVTGGGGGGSGKGKKLKLTNIVETIDVGVPVQLAYNQWTQFADFPSFMKKVERVEQ
FT                   EADEKLEWKAQIFLSHRTWEATILEQVPDERIVWRSKGAKGFIDGAVTFHEVTPDLTRI
FT                   VLILEYHPKGLFEKTGNLWRAQGRRARLELKHFARHVMTQSILHPDDVEGWRGEIRDGQ
FT                   VVEPEEDEAETEDEQDESQPDEGEEDETEEPAETDEYEDEEPEAEEDEADEADEGEGED
FT                   EEEEEEEAPPPPRRRGRPRKTAAAAVDQAPKQRGRPRKATATKTSSSRQGARR"
     atgacgagcg ccgcgaagaa actacgagag gccgcaccgg gtgacgggga cggatcgtcg        60
     agcgtgctgc aggaagcaat gcagaggctg gtcggcacgg tcgccgagaa ggcactgtcc       120
     tcggtctcgg acaaggtggc gaacacctcc gggcggctca ccgagtacgc cgagaacggc       180
     ggcgaaggag ggctgctcgc cgccctcacc ggttccgaga aatcggatga cgatgagtca       240
     ccggacgagt ccgacaccgg tggcggctgg tgggagggcg ccaagcagac ggtcaaggac       300
     aaggcgtccg acctcaagga cgcggtcacc ggcggtggtg gtggcggtag cggaaaaggc       360
     aagaagctga agttgaccaa catcgtcgaa acgatcgatg tcggggtccc ggttcagctg       420
     gcctacaacc aatggaccca attcgccgac tttccgtcgt tcatgaagaa ggtcgaacgg       480
     gtcgagcagg aagcggacga gaagctcgag tggaaggcgc agatcttctt gtcgcaccga       540
     acctgggaag cgacgatcct cgagcaggtt cccgacgagc ggatcgtgtg gcgctcgaag       600
     ggcgccaagg gtttcatcga cggtgcggtg acgttccacg aggtgacccc ggatctcacc       660
     cgcatcgttc tgattctcga gtatcacccg aaggggttgt tcgagaagac gggaaacctc       720
     tggcgtgcgc agggacgccg agcacggctg gaattgaaac actttgcacg ccacgtcatg       780
     acgcagtcga tcctccatcc cgacgacgtc gagggctggc gcggagagat ccgggacggt       840
     caggtggtcg agcccgaaga ggacgaggcg gaaacggaag acgaacagga cgaaagccag       900
     ccggacgagg gcgaagagga cgagaccgag gagcccgccg aaacagacga gtacgaggac       960
     gaggagcccg aggcagagga agacgaggct gacgaggctg acgagggcga gggtgaagac      1020
     gaagaggaag aggaagagga agcacccccg ccgccgagac gccgcggtcg cccacgcaag      1080
     accgcggccg ccgctgtgga ccaggccccg aaacagcgag gtcgcccacg caaggcaacg      1140
     gctacgaaga cctcgagctc gcgacaagga gcacggcgat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page