(data stored in ACNUC7421 zone)

EMBL: CP000431.PE205

CP000431.PE205       Location/Qualifiers
FT   CDS_pept        260087..260500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00205"
FT                   /product="gas vesicle synthesis protein"
FT                   /note="GO_component: GO:0012506 - vesicle membrane;
FT                   GO_function: GO:0005198 - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92041"
FT                   /db_xref="GOA:Q0SK95"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK95"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92041.1"
FT                   /translation="MTSIQPAGGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSL
FT                   VGIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGDVTEGGAKSKTKGA
FT                   LESAGEKLGDILGGGKEEPERERVSRKSTRGDK"
     atgacgtcga ttcaaccggc ggggggaggc ggcggcggag tcagcggtgg tcccagctcg        60
     agtagcctcg ccgacgtcat cgacaccatc ctcgacaagg gcctggtcat cgacgcctac       120
     gtgcgcgtct cgctggtcgg catcgaactg ctgacgatcg acgcacgcgt cgtggtcgcc       180
     agtgtcgaca cgtacctgcg gttcgcggag gccgtgaacc ggctcgagat cggcagtggc       240
     gagccgaaag gcctgacgga tctggtcggg gacgtcaccg agggaggcgc caaatcgaag       300
     accaagggcg cgctcgagtc cgccggtgag aaactcggcg acatcctcgg cggcggaaag       360
     gaagaacctg agcgcgaacg cgtttcgcgc aagtccacac gaggtgacaa gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page