(data stored in ACNUC7421 zone)

EMBL: CP000431.PE206

CP000431.PE206       Location/Qualifiers
FT   CDS_pept        260500..261288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00206"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92042"
FT                   /db_xref="GOA:Q0SK94"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK94"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92042.1"
FT                   /translation="MSTSNENTDSAEEPRTSGVYVYGIVPADVQAEEDAVGVCDGPVSI
FT                   VKHGDIAALVSEISVDRPLGKPEDLRTHAHVLDGTSRVAPVLPLRFGAVMTDEGAVEEE
FT                   LLAAHADEFAAALKELEGRAQYVVKGRYVEQAILEEIIEENEQASKLLGAIRDQPEETT
FT                   RDARMALGEIVSNAIEAKRDEDTQKVVEALESLSDSVNVREPTHEEEAAQVAALVEVAR
FT                   QEELEKAVGELAEQWDGRVDMRLLGPLAAYDFVVTQKPEG"
     atgtctacgt cgaatgagaa caccgactca gctgaggagc cgcgcaccag cggtgtctac        60
     gtgtacggca tcgtgcccgc ggacgtacaa gccgaagagg acgctgtcgg cgtgtgtgac       120
     ggaccggtca gcatcgtcaa gcacggcgac atcgcagcgc tcgtgagcga gatctcggtg       180
     gacaggccgc tcggcaagcc cgaggacctc cgaacccatg cgcacgtgct ggacggcacg       240
     tcgcgtgtgg ccccggtgtt accgcttcgt ttcggggcgg tcatgactga tgaaggggcc       300
     gtcgaggaag agttgctcgc agcacacgcc gacgagttcg ccgcggcgtt gaaggaactc       360
     gaaggccgag cacagtacgt ggtgaagggg cgatacgtcg agcaggcgat cctcgaggaa       420
     ataatcgaag agaacgagca ggcgagcaaa ctgctcggcg cgatccgcga tcagcccgag       480
     gagaccaccc gcgacgcccg catggccctc ggcgagatcg tgagtaacgc catcgaagcc       540
     aaacgcgacg aagacaccca gaaggtggtc gaggcactcg agtcgctgtc cgattcggtc       600
     aacgtccggg aaccgacgca tgaggaggag gccgcgcaag tagccgccct cgtcgaagtc       660
     gcgcggcagg aagaactcga gaaggcagtg ggagagctgg ccgagcagtg ggacggccgg       720
     gtcgacatgc gcctgctcgg accgctcgcc gcctacgact tcgtggtgac gcagaagccg       780
     gagggctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page