(data stored in ACNUC7421 zone)

EMBL: CP000431.PE207

CP000431.PE207       Location/Qualifiers
FT   CDS_pept        261292..261546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00207"
FT                   /product="possible gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92043"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK93"
FT                   /protein_id="ABG92043.1"
FT                   /translation="MGLLSFIATLPLAPVRGVISLAELIQRQVEEEAHNPASARRALEE
FT                   LEDARAAGEISAEEEEQAQQAILDRMTGTARPPSGTEKE"
     atgggtctgc tgtcgttcat tgccacgctg ccactcgccc ccgttcgtgg ggtgatctcg        60
     ctggccgagt tgattcagcg acaggtcgag gaggaagccc acaatcccgc gagtgcgcgg       120
     cgtgctctcg aggaactgga ggacgcgcgc gcggcaggcg agatttccgc cgaggaggaa       180
     gagcaggccc agcaggccat cctcgaccgg atgaccggga cggcacggcc gccctccggt       240
     acggagaagg agtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page