(data stored in ACNUC7421 zone)

EMBL: CP000431.PE208

CP000431.PE208       Location/Qualifiers
FT   CDS_pept        261553..261843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00208"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92044"
FT                   /db_xref="GOA:Q0SK92"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK92"
FT                   /protein_id="ABG92044.1"
FT                   /translation="MAEEQPPPLPAPEIAEIATHDIAQLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLAMYEVVLDLDGELLSYRRTRRYIRGVGDSGSASS"
     atggcagaag agcagccacc tccgttgccg gcacccgaga tcgccgagat cgcaacgcat        60
     gacattgcgc agttgaccgg caagaaaccg ctgggtgcga catcggtcat gccgaccgac       120
     gacggctgga cggtggaggt ggaggtagtc gaggatcggc gaatcccgtc gtcgacggac       180
     atgctcgcga tgtacgaggt ggtgttggat ctggacggag agctgttgtc ctaccgcaga       240
     acccgccgct atattcgcgg tgtcggtgac agtgggagcg cgtcgtcatg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page