(data stored in ACNUC7421 zone)

EMBL: CP000431.PE209

CP000431.PE209       Location/Qualifiers
FT   CDS_pept        261840..262247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00209"
FT                   /product="gas vesicle synthesis protein"
FT                   /note="GO_component: GO:0012506 - vesicle membrane;
FT                   GO_function: GO:0005198 - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92045"
FT                   /db_xref="GOA:Q0SK91"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK91"
FT                   /protein_id="ABG92045.1"
FT                   /translation="MTITGGGASNLPQSSGGGMGGGHQSTNLGEILERVLDKGLVIAGD
FT                   IQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERIAE
FT                   LESDRSVRPAVQAADTVEVEGKRRKPRNDRG"
     atgaccatca ccggcggcgg tgcgagcaac cttccgcaga gctcgggcgg cggaatgggc        60
     ggcgggcatc agtcgacgaa cctcggcgag attctcgagc gggtgctcga caaggggctc       120
     gtgatcgccg gagacatcca agtcaacctg ctcgatatcg aactgctgac catcaaggtg       180
     cgcctggtga tcgcctctct ggagaccgcg aaggaggtgg gcatcgattg gtgggagcac       240
     gacccctggc tgaccggcaa gaacagcgac gtcgaactcg agaaccggaa gctgcgggag       300
     cggatcgccg aactcgagtc cgacaggtcg gtccgccctg ccgtccaggc cgccgacacg       360
     gtcgaggtcg aggggaaacg tcggaagccc cgcaatgacc gcggatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page