(data stored in ACNUC7421 zone)

EMBL: CP000431.PE21

CP000431.PE21        Location/Qualifiers
FT   CDS_pept        27922..28803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00021"
FT                   /product="probable universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91857"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS9"
FT                   /protein_id="ABG91857.1"
FT                   /translation="MSGHRPIVVGIDGSPSSLQAVSWAAREAALRSSPLSLITTMFVPG
FT                   RYGVPIGVPASFFQDEERDGKERLERAAQTARAAVPGHDIEIDTTVCTGTPAGELLDRS
FT                   ADASMLVVGANRRGIVDRAVLGSVSSAVATHASCPVAVIRGEPDRDINDIPGPIVVGVD
FT                   GSQHSEPAISTAFEEAGLRQSELVAVHAWSDIVLQLSPDGGSEAEWLRDAANETALLSE
FT                   NLAGRAENYPDVKVRTLVVRDRPTRHLREQAENAQLLVVGSRGRGGFSSMLLGSTSRAL
FT                   MHSVVCPLLIVR"
     atgtccggcc atcgcccgat cgttgtgggg atcgacggct caccatcgtc gttgcaggcg        60
     gtttcgtggg cggcccgaga agccgcgctc cgcagctcgc ccctctcgct gatcacgacg       120
     atgttcgttc ccgggagata cggcgtcccg atcggtgtgc ccgccagctt cttccaggac       180
     gaggagcgcg acggtaagga gaggttggaa cgggcggcgc agaccgcccg tgccgcagtg       240
     cccggacacg acatcgagat cgacaccacc gtctgcaccg gcacgccggc aggtgaactt       300
     ctcgaccgct cggcggatgc ctcgatgctc gtcgtcggtg cgaatagacg gggaatcgtc       360
     gaccgtgccg tcctgggatc ggtcagttcg gcggttgcca cccacgcctc atgcccggtc       420
     gccgtgattc gcggtgaacc tgatcgcgat atcaacgaca tccccggacc gattgtcgtc       480
     ggtgtcgacg gatcacagca cagtgaaccg gccatctcga cggccttcga ggaagcaggt       540
     ctgcggcaat cggagctcgt tgccgttcac gcatggtccg acatcgttct gcagctctcc       600
     ccggacggag gcagcgaagc agagtggctg cgggatgcgg ccaacgaaac ggccctgttg       660
     tccgagaatc tcgccggtcg tgcggagaac tatccggatg tgaaggtacg caccctcgtt       720
     gtcagggatc gccccacccg gcacctgcgt gagcaggccg agaacgcgca gcttctcgtg       780
     gtggggagcc ggggacgggg cgggttttcc agcatgcttc tggggtcgac cagcagggcg       840
     ttgatgcatt cggtcgtctg cccactcctg atcgttcgct ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page