(data stored in ACNUC7421 zone)

EMBL: CP000431.PE210

CP000431.PE210       Location/Qualifiers
FT   CDS_pept        262234..263013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00210"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92046"
FT                   /db_xref="GOA:Q0SK90"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK90"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92046.1"
FT                   /translation="MTADEGVWLYSITTDRIGDAQLAGVTGVAGEPVRAVSSAGLVAVV
FT                   GTVSLSEFGQEPLQRNLEDLDWLAATARAHDAVVAAVLRCGPTVPLRLATLYLDDDRVR
FT                   LLLDERQDEFGATLRRVTGRSEWGVKAYGDAKALAQNVKEDPAATGAAGKGTAYLLRRR
FT                   AELSAQQDVERRAAGHADEIHSALLGHAVDGVRRQVTDPVLTGKRAWMIFNGTYLVDDE
FT                   RVDDFAALVSALDTARPGITLDLTGPWPPYSFAGIDG"
     atgaccgcgg atgagggtgt ctggctgtac agcatcacca ccgacaggat cggcgacgca        60
     caactcgccg gagtcaccgg cgtggcaggc gagccggtcc gcgctgtgtc gtcggctggt       120
     ctcgtcgcgg tggtgggaac ggtgagcctg agcgaattcg ggcaggaacc gctgcagcgc       180
     aacctcgagg acctcgactg gcttgcggca accgcgagag cacacgacgc ggtggtggct       240
     gccgtgttgc gctgcggtcc caccgttccg ttgcgactgg caaccctcta cctcgacgac       300
     gatcgcgttc gcctcctcct cgacgaaaga caggacgagt tcggcgcaac gctgcgtcgg       360
     gtgaccggac gaagcgagtg gggtgtcaaa gcgtacggag acgcgaaggc cctggcgcag       420
     aacgtgaagg aggatcccgc cgcgacgggt gcggcaggca aggggaccgc gtacctactg       480
     cgtcgccgtg cggagttgag cgcacagcaa gacgtcgaac gccgggcggc cggccacgcg       540
     gacgagattc actccgccct cctgggccat gccgtcgacg gggttcgacg gcaggtcacc       600
     gatccggtgc tgaccgggaa acgggcctgg atgatcttca acggcaccta cctcgtcgac       660
     gacgagcggg tcgacgactt cgctgcgctc gtttcggcac tcgacaccgc acgccccggc       720
     atcacactgg acctgaccgg accgtggccg ccgtactcct tcgccgggat cgacgggtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page