(data stored in ACNUC7421 zone)

EMBL: CP000431.PE212

CP000431.PE212       Location/Qualifiers
FT   CDS_pept        263220..263552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00212"
FT                   /product="gas vesicle protein, GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92048"
FT                   /db_xref="GOA:Q0SK88"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK88"
FT                   /protein_id="ABG92048.1"
FT                   /translation="MTEPEPVDSDAPTDIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQAIRRVEHGDLTDEQIERIGTTLMLLEERMAELREHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
     atgactgagc ccgagcccgt cgattcggat gcaccgaccg acatcggtcg ccgggttctg        60
     ccgcagcgaa tcgacgccga ccccgaatcc gtcgagaagg gcctggtcac cctggtcctg       120
     acgatcgtcg aactactgcg ccaactgatg gaacggcagg cgatacgccg agtcgagcac       180
     ggcgatctca ccgacgagca gatcgaacgc atcggcacga cactcatgct actcgaggag       240
     cgaatggccg agttgcgtga gcatttcgat ctcacccccg aggacctgaa catcgatctc       300
     ggaccgctgg ggccgctgct gtcgaacgaa tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page