(data stored in ACNUC7421 zone)

EMBL: CP000431.PE216

CP000431.PE216       Location/Qualifiers
FT   CDS_pept        265816..266136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK84"
FT                   /protein_id="ABG92052.1"
FT                   /translation="MNTFAVRSALAAAAALAVFATPGVAAAAPNLHGDPTTPGTQVQVE
FT                   SDPGDSNSYTCGAVGVAGAGVGSNSSGGAGQVNGAYFGPGPVQGGCVGSDGSVYFPTGN
FT                   AE"
     atgaacacat tcgcagtgcg gtcggcgctc gcggcggcag ccgcgctcgc cgtcttcgca        60
     acacccggtg tcgcggccgc ggcgccgaac ctgcacgggg atcccacaac gccgggcaca       120
     caggttcagg tcgagagcga tccgggcgac tcgaacagct acacctgcgg ggcagtcggc       180
     gtcgcgggag ccggagtcgg ctcgaattcc tccggtggcg ccgggcaggt caacggcgcg       240
     tacttcggtc ccggccccgt ccagggcggc tgcgtcggta gcgacgggtc ggtctacttc       300
     ccgaccggca acgccgaatg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page