(data stored in ACNUC7421 zone)

EMBL: CP000431.PE217

CP000431.PE217       Location/Qualifiers
FT   CDS_pept        complement(266165..266845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00217"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_component:
FT                   GO:0016021 - integral to membrane; GO_function: GO:0008119
FT                   - thiopurine S-methyltransferase activity; GO_process:
FT                   GO:0008152 - metabolism; GO_process: GO:0046690 - response
FT                   to tellurium ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92053"
FT                   /db_xref="GOA:Q0SK83"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK83"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92053.1"
FT                   /translation="MSERSGPLADPFSGRQPTSHERMTGRPWDASYHEGPAPWDVGRPQ
FT                   PAVVRVASEGGFAGAVLDAGCGTGENALHVASLGLQVLGVDVAETALAIARDKADDRRI
FT                   EVEFALADAFQLDGMGRRFDTVLDCGLFHTFDAAERPRYVASVASVTEHGGTVYVLCFS
FT                   DAGPDTGPHPVSREELRAAFDPGDGWKVAAIEPDRIETRFHDNGAPAWFATIERIHPVG
FT                   GPAR"
     gtgtcggagc gatcaggacc cctcgccgat ccgttcagtg gtcggcagcc aaccagccac        60
     gaacgcatga cgggacggcc ctgggatgcg tcgtatcacg aggggccggc gccgtgggat       120
     gtcggccggc cgcagccggc ggtcgtgcgg gtggcatccg aaggcggctt cgccggagcg       180
     gtgctcgatg cgggatgcgg caccggcgag aacgcgcttc acgtcgcctc cctgggattg       240
     caggttctgg gcgtcgacgt ggctgagacg gcactggcga ttgccaggga caaggccgac       300
     gaccgtcgga tcgaggtcga gttcgcgctg gccgacgcgt tccagttgga cggaatgggg       360
     cgccggttcg acaccgtgct ggactgcgga ctgttccaca cgttcgacgc cgccgagcga       420
     ccacgctacg tggcgagcgt ggcgtcggtg accgaacacg gcggaaccgt ctatgtgttg       480
     tgcttcagcg acgctggtcc cgataccggc ccgcaccccg tcagccggga ggagttgcga       540
     gcggcgttcg accccggcga cggatggaag gtcgccgcca tcgaaccgga tcggatcgag       600
     acgagattcc acgacaacgg cgcaccggcc tggttcgcga ccatcgagcg gatccacccg       660
     gtgggcgggc cggcccggtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page