(data stored in ACNUC7421 zone)

EMBL: CP000431.PE22

CP000431.PE22        Location/Qualifiers
FT   CDS_pept        28827..29423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91858"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS8"
FT                   /protein_id="ABG91858.1"
FT                   /translation="MHSPGPGSTLIEAQLPRYEQRILRTQAVRASAPATFAAIRRVDFF
FT                   RSPVVALPNRARIAIDTVRPRRGGAPIQRSRSEFRFDRLLEPDGGFHLLAEKPGHAMVL
FT                   GFIGRWWERGYGRVEWSPAEFGRFALPGYGVGAWGFTVLPYGAHTSVLLTEVRVHGTDD
FT                   TARRMFRRYWTVVGPFVTAMGGPILRLIRDEAESR"
     gtgcacagcc ccggccccgg atcgaccctg atcgaagcgc agctgccgag gtacgaacaa        60
     cgcatcctgc gtacgcaggc cgtacgtgcg tcggcgcccg caaccttcgc cgccattcgc       120
     cgcgtcgact tcttccggtc gccggtggtc gcgttgccga accgggcccg aattgcgatc       180
     gacaccgtcc gcccgcgtcg gggcggcgca cctatccagc ggagtcggtc cgaattccga       240
     ttcgaccggt tgctcgaacc cgacggcggg ttccacctcc tcgcggagaa gcctggtcac       300
     gcaatggttc tcgggttcat cgggcgctgg tgggagcggg gctacggccg cgtcgagtgg       360
     tccccggccg agttcggccg cttcgccctt cccggatacg gcgtcggcgc gtggggtttc       420
     acagttctcc cgtacggcgc tcacacgtct gtcctgctca ccgaggtccg cgtacacggc       480
     accgacgaca cggcgcggcg gatgttccgc aggtattgga cggttgtggg tccgttcgtc       540
     acggcgatgg gcgggccgat cctgcgcctg atccgtgacg aggcagagtc tcgctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page