(data stored in ACNUC7421 zone)

EMBL: CP000431.PE220

CP000431.PE220       Location/Qualifiers
FT   CDS_pept        268396..268773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK80"
FT                   /protein_id="ABG92056.1"
FT                   /translation="MPRLQIGVPWPVGGILSAKDVSTCRTLQVEPLDEGVHESGACLHR
FT                   RSVRRGRSRPVTRQIHSDDAVAGLDQRRDLIPPRRGGGCEARRQHHARRGSAVTVHGVV
FT                   DSSTAGFDGQHCFSYPPTVRG"
     atgccgcgtc tccagatcgg ggtgccgtgg ccggtcgggg gaatcctgtc cgcaaaggac        60
     gtgtcgacat gccgcacctt gcaggtcgag cccctcgatg agggcgtgca cgaatccggc       120
     gcgtgtctgc atcgtcgttc cgtgcggcgt ggccggagcc gtcccgtgac ccggcagatc       180
     cacagcgatg acgcggtggc cggcctcgat cagcgacggg atctgatacc gccacgacgt       240
     ggcgggggct gtgaagcccg ccggcaacat cacgctcgac gaggatcggc cgtcaccgtg       300
     cacggtgtag tcgattcgag caccgccgga ttcgatggac agcattgctt ctcctatccc       360
     ccaactgttc gcggctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page