(data stored in ACNUC7421 zone)

EMBL: CP000431.PE221

CP000431.PE221       Location/Qualifiers
FT   CDS_pept        268975..269316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92057"
FT                   /db_xref="GOA:Q0SK79"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK79"
FT                   /protein_id="ABG92057.1"
FT                   /translation="MHISLPHSQASRAANPSGAVNRRPRITLRNRFATAAVAAAIAVIP
FT                   LGAATTIATAAEHPVATVAAPTIPGDRGDHGDGPRHDRQRDQRQERRDQSMTLDELLIG
FT                   WNSSQIYQM"
     atgcacatct cacttcccca ctcccaggct tcgcgcgcgg cgaatccgtc gggcgcagtg        60
     aaccgtcgcc ctcgaatcac cctgcggaac cggttcgcca cggccgccgt cgccgccgcg       120
     atcgccgtca tccccctcgg cgccgcgacc accatcgcaa cagcggccga acaccccgtt       180
     gcgacagtcg ccgcacccac catccccggc gatcgtggtg accacggtga cggcccccgc       240
     cacgaccgac aacgcgacca acggcaagaa cgccgagacc agagcatgac gctcgacgaa       300
     cttctcatcg ggtggaacag cagccagatc taccagatgt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page