(data stored in ACNUC7421 zone)

EMBL: CP000431.PE222

CP000431.PE222       Location/Qualifiers
FT   CDS_pept        complement(269378..269848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK78"
FT                   /protein_id="ABG92058.1"
FT                   /translation="MDDIIDFVEGLGDVLTLRPAPGDGSPEISWGDTFFYYSPDRIVPD
FT                   RTQPFATIVTKNYPGDESSGLDRAGAFRVNIHAGKEAFIEATGHAPREQGVADVDAGAR
FT                   DTVIAHPVYGSLAWLAVIDPGSRTGEVTRALLCRAHALARSRYERRAESTPR"
     atggacgaca tcatcgactt cgtcgaaggc ctcggcgatg ttctgacgct caggcctgcc        60
     cccggcgacg gttcgccgga gatcagctgg ggtgacacct tcttctacta ctcaccggat       120
     cggatcgttc cggacaggac ccagcccttc gccaccatcg tcaccaagaa ctaccccggc       180
     gacgaaagct cgggtctgga ccgcgcgggt gcgttccggg tgaacatcca tgccgggaag       240
     gaggcgttca tcgaggcaac cggccatgca ccgcgagagc agggcgtcgc cgacgtcgac       300
     gccggtgcgc gcgacaccgt catcgcgcat cccgtctatg gctcactggc ctggctggca       360
     gtcatcgacc ccggctcgcg cacaggcgaa gtcacgcggg cgttgctgtg ccgtgcgcac       420
     gccctggctc gctcgcgcta cgagcgacga gcggaatcca ctccacgctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page