(data stored in ACNUC7421 zone)

EMBL: CP000431.PE223

CP000431.PE223       Location/Qualifiers
FT   CDS_pept        269918..270688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00223"
FT                   /product="possible transcriptional regulator, MerR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92059"
FT                   /db_xref="GOA:Q0SK77"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK77"
FT                   /protein_id="ABG92059.1"
FT                   /translation="MTSLQSRHLRTVDVARRAGCSVQHVRNLERDGVLPPATRTATGYR
FT                   IYTDVHVQSALAYRELAIGVGPVEATRIVRSVHTCPAATTVALLDAAHARLHTERTELA
FT                   LAKQAAEAISTEPVDDVQASDWMSVSELAAALGIRPSTLRHWDAEGLVVPDRDTPTGAR
FT                   RYSPSQVRDARVVHQLRKAGYRIAPLHAVMTQLGHTPGSGDIGAALAARDQATTARSRA
FT                   LLDATSALTVLLALREGGVSARATTPPPENRNPR"
     gtgacaagtc tccaatcgcg tcatctgcgg accgtcgatg tcgcccggcg tgccggatgt        60
     tccgtgcagc acgtacgcaa cctcgaacgc gacggggtgc tgcctcccgc aacccgcaca       120
     gccaccggat accggatcta caccgacgtg catgtgcagt ccgcgctcgc ctatcgggaa       180
     ctcgccatcg gcgtcggccc ggtcgaagcc acacggatcg tgcgcagcgt gcacacgtgc       240
     ccggccgcga caacggtcgc cctcctcgat gccgcgcacg cccgactcca cacggaacga       300
     accgaactcg cgctggcgaa gcaggccgct gaggccatct cgaccgagcc tgtcgacgac       360
     gtgcaggcat ccgactggat gagcgtgagc gaactcgccg ccgccctcgg catccgcccc       420
     tccacgttgc ggcattggga cgcagaggga ctcgtcgtcc cggaccggga cacacccacg       480
     ggagcgcgcc gatactcccc ttcacaggtc cgcgacgctc gcgtcgtgca tcagctacgc       540
     aaggccggtt accgcatcgc acctctccac gcggtcatga cccaactcgg gcacacaccc       600
     ggatcgggtg acatcggcgc cgcgctcgct gcccgcgacc aggccaccac agcccgctcc       660
     cgagccctgc tcgacgcaac ctctgccctc accgtgctcc tcgcactccg agaagggggg       720
     gtcagtgcgc gcgcgacaac accgccacca gaaaatcgga atcctcgctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page