(data stored in ACNUC7421 zone)

EMBL: CP000431.PE225

CP000431.PE225       Location/Qualifiers
FT   CDS_pept        271429..271851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92061"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK75"
FT                   /protein_id="ABG92061.1"
FT                   /translation="MPESVPDRVQITDRLHVVADLLDTKDWPGFAATLTEDVVAYGRTG
FT                   PVDVVARVRSHLDVCGATQHLLGNIRVDVDGDAARTRSYFRAFHVGLGERAGATYECLG
FT                   EYRDEWRRGPSAWLLAGRVIDVRAEIGDRGVIAPLS"
     atgcccgagt ccgttcccga ccgcgtccag atcaccgacc gcctgcacgt cgtggccgac        60
     ctgctcgaca cgaaggactg gccggggttc gcggcgacac tcaccgaaga tgtcgtggcc       120
     tatgggcgga cggggccggt ggacgtggtc gcgcgcgtcc gctcccacct cgacgtctgc       180
     ggtgccaccc agcacctgct cggcaacatc cgcgtcgacg tcgacggtga cgcggcgcgc       240
     actcggtcct atttccgggc gtttcacgtc ggcctcggag aacgcgccgg cgcgacgtac       300
     gaatgcctcg gcgagtaccg cgacgaatgg cgccgcggac cttcggcctg gttgctggcc       360
     gggcgggtga tcgacgtccg cgccgagatc ggcgaccgcg gtgtcatcgc acccctgagc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page