(data stored in ACNUC7421 zone)

EMBL: CP000431.PE226

CP000431.PE226       Location/Qualifiers
FT   CDS_pept        complement(271866..272957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00226"
FT                   /product="ABC sugar transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="tc: 3.A.1.2; GO_component: GO:0042597 - periplasmic
FT                   space; GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006935 - chemotaxis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92062"
FT                   /db_xref="GOA:Q0SK74"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK74"
FT                   /protein_id="ABG92062.1"
FT                   /translation="MKRRVRAFSVAAAVAAVVLGACAAPAPQGDDAQEKVFFFLPNTTT
FT                   TRFVERDEPLFTDFLELFAPEATVTVRNAEGDPARQQSQVESAIAEGASVLVLISTDAR
FT                   FSGGALTAAAEADVPVVLYDHDAVGGPADVQVIFDPLEVGRRQGSRAADLIAAMPGDGV
FT                   KIARVGGNLGEYGTRQFLLGQDEFLQPLADSGKIRVVCETAIDDWDPAEGQAFAEECLA
FT                   RENNDIALFVTMNDDLGGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQETLDNTIF
FT                   KNLSDQAKVAAQLTTSILHGDGIPEEIVNGTIDNQYMAVPTVFLPVQNITKDNLDVVVN
FT                   SGFYTWQQICAPDPASAVCGDHS"
     atgaagagaa gggtgcgcgc gttcagcgtc gcggccgcgg tcgcagcggt ggtgctcggg        60
     gcctgcgcgg cccctgctcc gcagggcgac gatgcacagg agaaggtttt ctttttcttg       120
     ccgaacacga cgaccacccg attcgtggag cgcgacgaac ccttgttcac cgacttcctg       180
     gagctgttcg cgccggaggc gacggtcacg gtccgcaatg ccgagggcga tccggcccgc       240
     cagcagagtc aggtcgagtc ggcgatcgcg gagggcgcgt ccgtgctcgt gctgatctcc       300
     acggacgcga ggttctcggg tggagccttg accgccgccg ccgaggcgga cgttcctgtc       360
     gtgctctacg accatgacgc ggtcggtgga ccggcagacg ttcaggtgat cttcgatcca       420
     ctcgaggtcg gccgacggca gggtagccgc gccgcggatc tgatcgccgc gatgcccggc       480
     gacggggtga agattgcccg ggtgggggga aacctcggtg aatacgggac ccgtcaattc       540
     ctgctcggcc aggacgagtt tctgcagccg ctcgccgaca gcggcaagat ccgcgtggtc       600
     tgcgagaccg cgatcgacga ctgggacccg gccgaaggtc aggcattcgc cgaggaatgc       660
     ctggcccgtg agaacaacga catcgcgctg ttcgtcacca tgaacgacga cctgggaggc       720
     ggaatcgtcg cggcactggc aggccgcggg ctcgccgggc ggatcccggt caccggcggc       780
     caggacgcca atctcgctgc gctgcaattg atcgcacagg aaaccctcga caacacgatc       840
     ttcaagaatc tgtccgatca ggcaaaggtc gcggcgcagc tgaccacatc gatcctgcac       900
     ggtgacggca ttccggagga gatcgtcaac ggcacgatcg acaaccagta catggccgtg       960
     ccgacggtgt tcctgcccgt gcagaacatc acgaaggaca acctcgacgt cgtggtcaac      1020
     tccggcttct acacctggca gcagatctgt gcaccggacc cggcatccgc ggtgtgcggc      1080
     gaccacagct ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page