(data stored in ACNUC7421 zone)

EMBL: CP000431.PE227

CP000431.PE227       Location/Qualifiers
FT   CDS_pept        273108..274472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00227"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92063"
FT                   /db_xref="GOA:Q0SK73"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK73"
FT                   /protein_id="ABG92063.1"
FT                   /translation="MFHQDRGAVSSGDRDTSTADEHLLNESLLVEPEVRRRPWREFLAS
FT                   TPGRLSLLAVVLVAVALTAGLVTSAVVAARQQRMETLRAHTEPLADAAQNLFSSLSIAD
FT                   AAATSSFIAGAIEPLAVRDRYNQALGDASNALVTASYGVTSGDVESLRLLTEMSRHVAV
FT                   YTDLVATARSNDSAGNPVGVAYLGTASALMQDTILPLAEHLYNDQARAVADTQSHTARL
FT                   PATAIVVASAGVVVLAVAHAYVAHRSRRRVNPGLACATVLLAALVVWIVIAGLLSTSAS
FT                   ERARIDGAEPLAAVTKARILAQQARADETLGLLRPGFDPAGSDYARHTDALSAILNSDA
FT                   SRNTVIAPTIADASAAFDGWRSAHRDLQQKLADGDYQGAADVAVGPGATASTAQFRALD
FT                   ESLEDAITALRTEELDAMRESYRTMAALAVGGIVLAVSAALAVVAGIEPRVSEYH"
     gtgttccacc aggaccgcgg cgccgtatcc agcggagatc gtgacacttc gacggccgac        60
     gagcatctcc tgaacgaatc ccttctcgtc gagcccgagg tccgccggcg cccctggcgc       120
     gaattcctcg catcgacacc cggacgcctg tccctcctcg ccgtcgtcct cgtcgcggtg       180
     gcgctgacgg ccggtctcgt gacgtccgcc gtggtcgccg cgcggcagca gcgcatggaa       240
     acccttcgcg cccacaccga accgctggcg gacgccgcgc agaacctgtt cagctcgttg       300
     tcgatcgccg acgcggcagc gacatcgtcg ttcatcgcgg gtgccatcga gccgctggcg       360
     gtgcgcgacc ggtacaacca ggcgctcggg gacgcgtcga acgcactcgt caccgcgtcg       420
     tacggcgtca cctccggcga cgtcgaatcg ttgcgactgc tcaccgagat gtcgcggcac       480
     gtcgccgtgt acacggacct ggtggcgacc gcacggtcca acgactccgc gggaaatccg       540
     gtcggggtgg cgtatctcgg aaccgcttcg gctctgatgc aggacaccat cctgcccttg       600
     gccgaacacc tctacaacga ccaggcccgc gccgtcgccg acacgcaatc ccacaccgcc       660
     cggttgcccg ccaccgctat tgtggtcgcg tcggccgggg tcgtcgtcct cgccgtcgca       720
     cacgcatacg tggcgcatcg aagccgtcgc cgggtcaatc ccgggctggc gtgcgcgacg       780
     gtcctgctgg ccgcactcgt cgtgtggatc gtgatcgccg ggctgttgtc gacgtcggcg       840
     agcgaacgcg cacggatcga cggcgccgaa cccctcgcgg cggtcacgaa ggcgaggatc       900
     ctcgcccagc aggcccgcgc cgacgagaca ctgggactgc tccggccggg tttcgatccg       960
     gccgggagcg actatgcccg gcacacggac gcactctccg cgattctgaa ctcggacgcg      1020
     tcgcggaaca ccgtgatcgc gccgacgatc gccgatgcgt ccgccgcgtt cgacggatgg      1080
     cggagcgcgc accgggatct gcagcagaag ctcgcagacg gcgactacca gggcgcggcg      1140
     gacgtcgcgg tcggtccggg cgcgacggca tcgaccgccc agttccgggc cctcgacgaa      1200
     tcgctcgaag acgccatcac cgccctgcgc accgaggaac tcgacgcgat gcgggagtcg      1260
     taccgcacga tggcggcgct cgccgtgggt ggcatcgtgc tcgctgtttc cgcagcgctc      1320
     gccgtcgtcg cggggatcga accccgagtg agtgagtacc actga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page