(data stored in ACNUC7421 zone)

EMBL: CP000431.PE228

CP000431.PE228       Location/Qualifiers
FT   CDS_pept        274472..275461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00228"
FT                   /product="ABC amino acid transporter, periplasmic substrate
FT                   binding protein"
FT                   /note="tc: 3.A.1.3; GO_component: GO:0016020 - membrane;
FT                   GO_component: GO:0030288 - periplasmic space (sensu
FT                   Proteobacteria); GO_function: GO:0000287 - magnesium ion
FT                   binding; GO_function: GO:0004970 - ionotropic glutamate
FT                   receptor activity; GO_function: GO:0005234 -
FT                   glutamate-gated ion channel activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92064"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK72"
FT                   /protein_id="ABG92064.1"
FT                   /translation="MVRTHPERRPRSTRLLGCLAFGAVLIAGCGAPDAPAPRFSGDFTE
FT                   FPLSAGAQLIAPSDTPPPDTETPACAAPASLRPGTPSFGGTLGDIRARGTVVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPTKVEFRPLGTDDGAEMLADRDADMVVR
FT                   PVALPCQGLQDLTFSTVYLEASRRLVVRDGSGISGPADLARRRVCTHHDPASMSALSRI
FT                   APKATILAVPDWDDCLMAIQQRQADAVAGAAFLAGLVAQDPNLEIVGPETDSAQYAIGL
FT                   APGNDDLVRFVNGTLERLRTDGTWAALYERWLSSLGPAPGPPAPEYRD"
     atggtgcgaa cacacccgga acggcgaccg cgctccaccc ggctgctcgg gtgcctcgcg        60
     ttcggcgctg tcctgattgc cggctgcggc gcccccgacg cacccgcccc gaggttctcc       120
     ggagacttca cggagtttcc cctgtcggcc ggcgcccagc tcatcgcacc gtccgacacg       180
     ccgccaccgg atacagagac gccggcatgc gcagcaccgg ccagcctccg cccggggact       240
     ccgagtttcg gcggcacgct cggcgatatc cgtgcccgcg gcaccgtggt cgtcgcggtc       300
     gatcagaaca ccaacctgtt cagtttccgc gacccgacga ccggcaccct caccggattc       360
     ggtgtcgacc tcgctcggga ggtcgcacgt gatctgctcg gcgatcccac caaggtcgag       420
     ttccggccgc tcggaaccga tgacggcgcc gagatgctcg ccgaccgtga cgcggacatg       480
     gtcgtgcgtc cggtggccct cccctgtcaa ggtctccagg acttgacgtt ctccacggtg       540
     tatctcgagg cctcacgccg gctcgtggtg cgggacgggt cgggtatctc cggtccggcc       600
     gaccttgccc ggcgacgggt ctgcacgcat cacgacccgg cgtcgatgtc ggcgctgtcg       660
     cgcatcgccc ccaaagccac gatccttgcg gtccccgact gggacgactg tctcatggcc       720
     atccagcagc ggcaggccga cgcggtcgca ggcgccgcct tcctcgccgg tctcgtcgcc       780
     caggatccga atctcgaaat cgtcggtccc gaaacagatt ccgcccagta cgccatcggc       840
     ctcgctcccg gaaacgacga cctcgtccgg ttcgtcaacg gcacactgga acgactgcgc       900
     acagacggaa cctgggcggc cctctacgag cggtggctgt cgtcgctcgg cccggcaccc       960
     ggaccaccgg ccccggagta ccgggactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page