(data stored in ACNUC7421 zone)

EMBL: CP000431.PE229

CP000431.PE229       Location/Qualifiers
FT   CDS_pept        complement(275519..275923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK71"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92065.1"
FT                   /translation="MELVERAVSAEIDAAARAVITAAAAEASRHADEIIGTGPLPGTAE
FT                   WDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTRQS
FT                   AHERWGSRTTALLDPMGTGLPKTVADDDPS"
     atggaactgg tcgaacgcgc cgtcagtgcg gaaatcgacg ccgctgctcg cgcggtgata        60
     acggctgcgg ccgccgaagc aagccgtcac gccgacgaaa tcatcggcac cgggccgctt       120
     cccggcacgg cggaatggga cgccgagcag ggcacggaca ttcccaacca gcgaaccctg       180
     gcctggcacc tgctgagtct tcgtatacag ctcgctgccg gcctggacgg catcgaaacc       240
     gttctcggcc tgcgctttca gggagcgacg tgggcgacca tcggcaaggc cgccgggatg       300
     acccgccaat ccgcgcacga gcgatggggt tcgcgcacca cggccctgct cgacccgatg       360
     gggaccggcc tgcccaagac cgttgccgac gacgatccga gctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page