(data stored in ACNUC7421 zone)

EMBL: CP000431.PE23

CP000431.PE23        Location/Qualifiers
FT   CDS_pept        complement(29439..30749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00023"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91859"
FT                   /db_xref="GOA:Q0SKS7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91859.1"
FT                   /translation="MMSDDRHEQLGSGDLITLVSDVGPVPMNVGAILFVAGEGDVDAAT
FT                   VEATFTRRLTSIRRLQQRLATPRRGLGRPYWVDDSDFDVHAHVSRVRCPCPGERDAALA
FT                   IAVDAVTRPLPRSRPLWRAVVVTGLTGGHIGLVLVLHHVVADGIGGLAVLARVVDGADA
FT                   AGPADNTAAPPRGRFVDCVADRTRTLRRLPRTVSRIRDGWAELGRGRLGWAPRCSLNVP
FT                   TGSRRTVTTVDVGLDRVRAAGRRSGATVNDVLLVAVTGALATLLHERKEFPQELVVSVP
FT                   VSARSTTTSGYLGNQVGVMPVRVPLEGSVEERLAAVSRITRARKMRTRGTSSALIGPLF
FT                   RILAAVRLFRRLVDRQRLVNSFLTNLPGPAGQLVIAGAPITDITPITVTAGNVGVAFAA
FT                   LSYAGTLTVTIVVDPDVVPEIRELAAYLREQFRAAIE"
     atgatgtccg acgaccgtca cgagcaactc ggctcgggcg acctgatcac gctcgtctcg        60
     gacgtcggac cggtacccat gaacgtcggc gcgatacttt tcgttgccgg tgaaggtgac       120
     gtggatgcgg cgaccgtcga ggccacgttc acacgacggc tcaccagcat tcggcgcctg       180
     caacagcgcc tggccacgcc acggcggggc ctggggcggc cgtactgggt cgacgactcc       240
     gatttcgacg tccacgccca tgtgtcccga gtacggtgcc cgtgcccggg cgagcgtgac       300
     gctgcgctgg caatcgcggt ggacgcggtg acccggccgc tgccccggtc acgaccattg       360
     tggcgggcgg ttgtcgtcac cggtctcacg ggcggtcaca tcggtctggt gctggtgctg       420
     catcacgtcg tggccgacgg gatcggtggc ctcgcagtgc tcgcgcgtgt cgtggacggc       480
     gcggacgcgg ctgggccggc cgacaatacc gcggcaccgc ctcggggccg gttcgtcgac       540
     tgcgttgccg accgtacccg gacgctgcgc cgacttccgc gcacggtgtc tcgtatacga       600
     gatggttggg ccgaactcgg tcgtggtcgc ctcggatggg cgccgcggtg ttccctcaac       660
     gttcccaccg gttcccgtcg cacggtaacg acggtcgacg tcggcctcga ccgtgtccgg       720
     gcagcggggc ggaggtcggg ggccaccgtc aacgatgttc tgttggtcgc cgtcaccggc       780
     gctttggcca cactcctgca tgagcggaag gagtttcccc aggaattggt ggtgtcggtc       840
     cccgtctcgg cccggagtac gacaaccagc gggtatctgg ggaaccaggt cggcgtgatg       900
     cccgtccgcg taccgctgga aggaagcgtc gaggaaaggc tcgccgctgt ttcgcgcatc       960
     acccgcgccc ggaagatgcg gacccgaggc acatcctcgg cactgatcgg accactcttc      1020
     cggattctgg ccgcggtgcg gttgtttcgc cggctcgtcg atcgtcagcg actcgtcaac      1080
     tcgttcctga ccaacctccc gggccccgct ggacaactcg tcatcgccgg tgcaccgatc      1140
     acggacatca ccccgattac cgtcaccgcg gggaacgtcg gcgtcgcgtt cgcggcactg      1200
     tcctatgcgg gcaccctgac cgtgacgatc gtcgtcgatc ccgatgtggt ccccgagatc      1260
     cgcgagctcg cggcgtatct gcgcgaacaa ttccgggccg cgatcgagtg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page