(data stored in ACNUC7421 zone)

EMBL: CP000431.PE231

CP000431.PE231       Location/Qualifiers
FT   CDS_pept        complement(276965..277291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK69"
FT                   /protein_id="ABG92067.1"
FT                   /translation="MVVVEGYSNMRGHAMSSSAPTAARSRRAENWSAAMASNPTDVSNF
FT                   LVSESPSPTLVVESEASCTACPHSADSHDELGIRFCAVTSARSLERKCICAGDQVSGQH
FT                   YSRY"
     gtggtggttg tcgagggtta ttcgaatatg cgcggtcatg ccatgtcgtc ctcggcgccc        60
     accgcggccc gcagtcgaag ggccgagaac tggagcgccg ccatggcgtc gaacccgact       120
     gatgtgtcaa atttcctcgt ctccgagtcg ccgagcccca cgctggtggt ggaatcggag       180
     gcatcgtgca cggcatgccc acacagcgcg gattcccacg acgagctcgg gattcggttc       240
     tgtgccgtga cctcggcgcg aagcctcgaa cgcaagtgca tctgcgccgg tgaccaggtg       300
     agtggacagc actactcccg gtactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page