(data stored in ACNUC7421 zone)

EMBL: CP000431.PE232

CP000431.PE232       Location/Qualifiers
FT   CDS_pept        277548..304163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00232"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92068"
FT                   /db_xref="GOA:Q0SK68"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK68"
FT                   /protein_id="ABG92068.1"
FT                   /translation="MDTRNRSDATVRSRPDAFPLTPVQRGIWLAQRLAPDVPRCIAQYV
FT                   EVRGALDLAALDDASVTAGREFQSAFLRVFEIDGQPFQIVDPTIELSTGYVDLGDEPDP
FT                   VAAAHAWMTRDYTAPLDPTRDRLATSTVLQIGDDCYLWYSRIHHVALDGYGAMTLVNRI
FT                   AALYTARVEARTPQPAGAADLRTLHRLDEEYRSSRHYESDRAYWRDRLAGLRSNSSLSP
FT                   TVAPAVADSILEKTLLSTAATERLDRSGERLGTPPATGVIAAFATYLARMTGQDDVVVD
FT                   LPVSGRTTTLLQRSGGMLVGLAPLPVATAPDDTVASLTRRVHHEILGALRHQRFTLEDI
FT                   RRETDAAESLCGPMVNVMLFHRRIQFGPLTGDFHVVTSGPVEDLLVNVYRTTAAGRTVI
FT                   EFRGNPHRYSRDELARHHRSFVGLLEEFLAADPGDPVAEVHTESAHEGDRIHRRTAHLD
FT                   YWRTMLTDLAHDTPLPRDHTRRAGTVDGRREHVEAHVTADLHHRIETLGRDCPFATYTV
FT                   THAAVAALLARLGGVRDVVLGTPAGSGGWPLVLRMRVDGTESFTELVERARTTELGAFT
FT                   HADVSFDEIAAALAIPAASAGRHPFQVGFDLQTSDHPHEPDSRSDEGADLWIHIVEHPG
FT                   RAGLDLRLTFARELFEPSTIRGFADRLVRVLDQVTAHPDIPIADLDLLSSAEWRRLVPA
FT                   RGDPGVPPRTLPEILANAAHRDPDAIAVVDAAGDGTGITYRQLDAESTQLARVLLSRGA
FT                   GPETVVALALPRSADLVRAVWAVAKSGAAFLPVDPGYPEARIAHMLTDSGANLGVTVSR
FT                   HRGDLPGDVEWIELHDRNADDTTSVRTSTPVGDADRPRPLRWDHPAYLIYTSGSTGVPK
FT                   GVVVTHRGIANLIAAQIKGLDVPPTGRVAQFASPSFDASLFELLAAVGSGARVVIVPPE
FT                   VVGGTELERVLTDYQVTHAVLTPTTLATLEPRGAPTLSHLTVAGEVCPPEVVSTWAPGP
FT                   RVVNAYGPTEATIMSTISAPLVPDEPVSLGAPACGFEVVVLDDRLHPVPPGTVGELYLA
FT                   GPGLARGYRNRAGLDAVRFVAAPFGSPGTRMYRTGDLVRWRVRHGEDPSAALDLAYVGR
FT                   SDFQVKVRGFRIELGEIEAVLRADPSVGFAVATAATDPNTGDAAVIAYVHPAEGRRVDV
FT                   GEMHRRLARTLPAHMLPAAVVPLDVIPRTPSGKLDRAALPAPTFAPRSGAGHRPRTPTE
FT                   ETVASVFETVLGVTGVGVDDDYVDLGGGSLAATRVVARLNSALETSLDVRDLFEHPTVA
FT                   ALADIVESRRGDGSERPPLRRFPRPARIPLSPAQERMWFVNQYDPHSPAYDIPLVVRLT
FT                   GHLDVGALEAAIADVVERHESLRTVYPTSDDGPHQVILPAERALPRVETVRVDGPTGLD
FT                   AHVAGAAAAPFDVTVDAPLRASLFTIGDTDHVLALVIHHIAADGASAGPLARDLSAAYR
FT                   ARVEGRAPAWEPPAVQYVDYALWQHALLGRPTDPDSLASRQLDYWSESLRGSPPLLALP
FT                   TDRPRPQRRSLHGGRVDFHLPPELHAGMRALSRTCTSTLFMTCHAALAVVLARLAGTYD
FT                   VSIGTPVAGRGEPALDDVVGMFVNTLVLRTRIDPEAGFADTVRTVRDVDLGAFAHADYP
FT                   FEKLVDSLEPERTDSRSPLFQVLLEFQNVLPAGHEARELDLPGLHVAAVGYDPKICKFD
FT                   LQVWLSERRDDGGAPQGIDGRIVYATDLFDEETVRGLADRLVRVLNIVTTEPDTVVGNI
FT                   DLLTDRERDVALRSWTAPDEPGPATTLPAEFARTAARQPDAVAVSFAGDTLSYGELADR
FT                   VNRIARLLHDHGAEPERLVAVAIPHSMDYVAVTLGVLAAGGACLPLDPGWASPTQTSRT
FT                   IPDIAIFVTISAVEEHLPHGHVPTLVLDAPGTVADLARRSGHPLTAVDVGAGPSPDTAA
FT                   YVLLTRGSTALPKPVSVTHRAVLSALARPAVPAGEVWAMVPTFAPGVTVLTPWSAFLHG
FT                   GRLEVVDDATASAPSALADLLHRRGVNMVAQTPAAYEHLSRARESAPAADELRSVLLTG
FT                   DPVDAAVVAAPEVVAVYASVEAVWFAAATDRAPEAGADRMEYRPARGRRFAVLDDRLAP
FT                   VPPGVVGELYIGGPTLARGYHRRAAATSTHFVASPLGPPGERMLRTGDAACLTPTGGLN
FT                   ILWRRDFQSELRGYRIPLGDIDTVLTAHPQVANAVTVDHTPRAGKPALVTYVVPAPGST
FT                   TTISEVRAHAAMILPPPWVPGAVVVLDRLPVTETGDVDLDALPVPEELRHAPVYHAPAT
FT                   PTEKTVSRVIAQVLGIGGVGVDDNFFELGGTSLDAAKVVARIDSAFGTRIGIRSLFEAP
FT                   TVRGLATVLDASEVHPDRPALGPRAHTEPAPVSFAQQRMWFVNQFDVTSAVYNVPMVVR
FT                   LTGLLDVPALHAALIDVLVRHEPLRTLYPLTDTGPVQVVVPAESVPVDLAPIPVADAAR
FT                   VSGLVDEVVAEGFDVTVRPPVRVRLWQLDDHAHVLAVVVHHIVADGSSLAPLARDLSTA
FT                   YTARRVGRAPVWEPLPVRFSDFAVWQREVLGSVTNPASPVARQLDFWRTALADLPERLE
FT                   LPLDRPRPATASYRAAAVPFVMPERTHRRLIDFARAHDTTTFVVIHAALAVLLSRLAST
FT                   TDVVVGSPTAGRGEQTLDPLVGMFVGTLVLRTTVDPASPFGAVVAAVRDADLAAFAHAD
FT                   IPFETLVDELHPPRSAALHPLFQVMLSFQNIEPPCLGLPGLEAHVTDLEPRVSPFDLNV
FT                   VVREQPAEDGSLTGISGQIVYATDLFDAGTIRAFSSRLLRVITAALTNPETVVGDVDIL
FT                   DDAERGLVLDRWNATAHDLPATTIVDLFEAQVAATPDAPAVRGEDRILTYAELDTWSTR
FT                   LAHSFLARGIGTESIVALVIPRSVEMLAAMYAVVKSGAAVLALDPSHPTDRIESLIQSA
FT                   SAALVVTTGDADVPVPTGLPVARFDDIDHEARDTAPVTDVDRGASLHPDNLAYVVYTSG
FT                   STGAPKGVAVSHAAIANQLAWSQAQLPIHEHDRTVQKAPIAFDVAIWECFAALCSGSVL
FT                   VLLPPDRQFDLDYLSGLLDDMQITVVEFVPSLLDVFVNDHRHSFPGSLRRVLTGGEAIS
FT                   ARTASSVLAQGVRLGNMYGPAEAAVTATYHDVAAARAATTVPIGSPVWNTQVYVVDGRL
FT                   HPVVPGVTGEMYLGGAQLARGYLGRPGITAGRFVANPFGAPGSRMYRTGDLARWNPDGQ
FT                   LDYHGRTDFQVQLHGYRVEPGEVESALLRHPGIAQAVVVPRADRNGAHHLVGYVVPVPG
FT                   IDVAEEELLDHTRSLLPSHMVPSAVISLSTLPLTPHGKVDRNALPIVDFTTRAAEFRSA
FT                   GTAVEESLVTLVRDVLGLESVGVDDSFFALGGDSIMAIQLVARAKTAGLALTPRDVFEY
FT                   KTIARLARAISTRPEPRAVLSELPGGGIGSFPLPPAARWLLERGGDLDTFCQSVLLTAP
FT                   PDLNTDTLTATVQTVLDHHDMLRARLRRGTTDEDTVLEVVAAHQAPRVESLIRRVALDD
FT                   PADLKGRAEVESRAAATRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVSWRILI
FT                   PDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPDPPLGT
FT                   RPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTTWRHRH
FT                   HTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTGGPATG
FT                   HALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPPSRPEA
FT                   GWMPVTDVDLSRRPDSDLAAAAVLTIDAATVVTEGAARLTATWSYAAGVLAATDVDDIT
FT                   ELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWPLTPLQAG
FT                   LLFHAELGGPAADAYVVQLVLDISGPLDADRLRDAGAALLGRHPNLGAAFTHTADGTPV
FT                   QVVTTTALAWAHHDVTTAHRPAAELGDIVTADRAAPFDPAEPPLLRFTLVTTGPDDHHL
FT                   VLTNHHLVLDGWSTPLLLHELLQLYESHADPDALAPVRPYRDFLEWLGTRDVSASVAAW
FT                   GRALEGVEDATRLAPGLEPHRDPGPCAERVVALTAAETDALRTVARTHDLTLHTIIDTA
FT                   WALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTLTTLLTR
FT                   THTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTSATDATH
FT                   YPLALAATTDTTLHLRGIFQLSAFDADSVDAILGQLARVLVAMGSDASLPIARLNLLDA
FT                   AEQRAVVPALGEAADEPRTLGAILGDAAERSPDAVAVDDGARRLTYAELEARALLLADR
FT                   LVESGVGPESVVAIAIPRSLESVLAVWAVAGTGAAFVPVDPTYPQIRIQHMVADSGVLV
FT                   GLTTSSRRDALPDTVTWIDIEGTGAGRLPHAGVSEACPAPTIRPDNAAYLIYTSGSTGV
FT                   PKGVVVGHRGVNSLATTLRECTGVTAASRVAHFASPSFDASVLEYLLTWSAGATAVIVP
FT                   TTIYGGDELRRHLADSRVTHAFLTPTTLTALDPDGLDDLECVVTGGEKCTPEVIRRWSP
FT                   HCRLINAYGPTESTVAADISDDPAADGANVIGGPIRGVTEVVLDARMQPVPIRARGELY
FT                   IAGDAIARGYHGKPALTATRFVADPFGPPGGRMYRSGDVVRWNTGREGSAVLEYLGRTD
FT                   SQVKVRGYRIEPGEIDAVLSGHPAVTFSATLPSTGGPDTTDQDATLISYVTTAGAAGPR
FT                   ELRDYLAGRLPAQLVPSAVIEIDVVPRTPSGKLDRDALRALRSTPLPAQVSAANPLEQT
FT                   VAETLAAALDLSSLGVDDDFFAAGGDSLTATRAVARVNTTLHTDLAVRSLFEAPTPRAL
FT                   ARLLLDDTQSEPRPPLTAAAQEPEYAPLSPAQQRIWFLNQYDTTTPTYNIPLTLHLTGH
FT                   LDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTTETQLPHHIN
FT                   TDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDLTTAYTAHTH
FT                   HQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPDTLPLPTDRP
FT                   RPTHRTHHGESIRFEIPADVHHRLRALARSTGATTFMTLHAAFAALLARLCDTDDVVIG
FT                   TPVAGRPDPRLDQLVGMFVGTLVLRTPVDSAGSFREVLTRTRDADLGAFMHADLPFEML
FT                   VDILAPERSTTHTPLFQVLIDYGTEVPLHLELPDLTVTVAEDTPPLAKFDLQLTLREHA
FT                   DAANPGLSAAFTYATDIFDRTTVEGVAARFLRLLDSVTADPGRPVGDVDLLDATERTAL
FT                   TTGSSTPSPPAEPVEAILADRFTRSVRRFADESALTDTGETLTYAALGARVYRLARHLV
FT                   ELGAAPDTVVAVALPPSIDLVVALLAAQQAGAGYLALDVGHPADRLDATMSDAAPVCLV
FT                   STTDHAARLRRNLPTVLADDADTRAHLLDLSPDPITDPERRAALTPDAVAYVVYTSGST
FT                   GRPKGVVVTHRNLTTLFDNTRTAFDFAETDVWTLFHSAAFDFSVWELWGALLHGGRLVI
FT                   VDTVTARAPDEFLSLLRRERVTVLCQTPTAFAQLATAERNQPTDLALRYVVFGGEALEH
FT                   GHLVDWLDRHDHTRPQLVNMYGITETTVHVTRHPLGDPRPAARSVIGRAIPGLRVYVLD
FT                   RRLHPVPTGVTGEMYVAGNQVTRGYLHRSGLTVTRYVADPAGRGGRMYRTGDLARWNAQ
FT                   GQLEFLGRSDAQVQLHGYRIEPGEVEATLVRHPDVAQAAVSVRPDDRGTERLIGYVVPV
FT                   RDGEQTRAVDIDRVLGFARTILAPHMVPATLVVLDRLPLTPNGKLDRRQLPAPDFAERV
FT                   STGRAPVTASELALAEIFAEVLGVPSVSADESFFALGGDSIMAIQLVSRAHEDGVFVTP
FT                   RDIFEHQTVAALAEVAATVKQDVLAELPGGGVGTAPLVPIARWLLERGGDLDTFCQSVL
FT                   LTAPPDLNTDTLTATVQTVLDHHDMLRARLRRGKTDQDTVLEIPPAGTIAAAPLITHVA
FT                   VETHSDNDLAATARAQLDAATHRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVS
FT                   WRILIPDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPD
FT                   PPLGTRPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTT
FT                   WRHRHHTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTG
FT                   GPATGHALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPP
FT                   HGLSNGAGWEPITSIEFDTTILGNVPVAAILDVNAYVYESGGAPILRTTWVYPPGVLPA
FT                   ADVTELTELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWP
FT                   LTPLQAGLLFHHELTSQDLDTYVVQLVLDIDGPLDPDRLRDAADALLGRHPNLRAAFGH
FT                   TPDGTPIQIITPAILPWNHHDLSDERDGTVAHDIVTADRTTAFDLTAPPLLRLTLITHG
FT                   PTHHQVALTHHHILLDGWSTPLLLHELLQLYEHHTDPGAVPRPLPYRRYLEWLTQQSLE
FT                   ESRAAWADVLDGLEGPTILVPSARGRVPSTFPEEYRVSLSREHTDALRTVARTHDLTLH
FT                   TIIDTAWALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTL
FT                   TTLLTRTHTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTS
FT                   ATDATHYPLALAATTDTTLHLKFEFLPEFLSRKDTEAIAAHMCRALDVIATAPDTTVAS
FT                   VRLLGDDEFRALAPVRGGPAPATRTLATIVTDAAALDPDAVALEDSGRAVSYRDLDEAS
FT                   NRLARLLITRGAGPERYVALAIPRSADSVLAVWAITKTGAAFVPIDPGYPAARITDMIA
FT                   DSGVALGVTLTPQRERLPATVPWLVLDEPGTVTMVEQQPSGAVGDADRRRPLRPDHPAY
FT                   MIYTSGSTGVPKGVVVPHRGLATLAAAQAAGLGPGRHSRVLHFSSPSFDGSVFDYLLAF
FT                   GCGATLVISPPTIVGGTELSRFVAAERVTHAFVPTAALASADPDDLDGYDGFGEILAAG
FT                   EACPPGLVTRWSRGRALRNGYGPTETTVMSNISAPLAPGSDVTIGGPIAGAEEVVLDAR
FT                   LQPVPDGVPGELYIAGPGLARGYHRRPGLTAGRFVAAPYGPAGERMYRTGDIVRWIADT
FT                   SGGRVVEYLGRADFQVKVRGFRIEPAEVDAVLGAHPDVEYAATLTRTGPAGDPILVSYV
FT                   VGSAELAPALLSAYLTERLPAHMVPSAIVPIDRIPLTPVGKLDRAELPDPRFDSPADPA
FT                   HRPTSPVEETIANAFAAVLGLEHVGVDDNFFEAGGNSLTATRVVARVNSTLHTHIDVRT
FT                   LFEDRTPRVLSTHLDHDSNDAPLPVPTPGPQPEFVPLSPAQQRIWFLNQYDTTTPTYNI
FT                   PLTLHLTGHLDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTT
FT                   ETQLPHHINTDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDL
FT                   TTAYTAHTHHQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPD
FT                   TLPLPTDRPRPTHRTHHGDRVVFHIGRDLHRSLSALARQNNSTLFMAIHAVFAVLLARL
FT                   SGSSDIVIGTPVAGRPDPRLDPLVGMFVNTLVLRTPVDGSRSFTEVLDRTRDVDLGAFL
FT                   HADLPFERVVEAVDPARSTSRSPLFQVSLEFESVQRPEITLPDLTVTVAEYTPPVVKVD
FT                   LELVVAETFDESGDPNGIAAGFTYATDIFDAATVQGFADRLTRLLAAVVADPDHPVGDL
FT                   TLGDEDEDTSVSGPPGLPARVWPDLLTEAVERHADRLAVSDAGRALTYRQLGEDSAQFA
FT                   RLLIARGAVPEGVVALALPRSIAWVRAVWAVARSGAASVPVDPTYPLTRIAHMLADAGA
FT                   ALGLTVAGYRAQLPDTVEWLVLDDPDFETQTRHFPSTPVTDVDRTAPLRTDNPAYLIYT
FT                   SGSTGAPKGVVVSHRGLANLFEQERHHLHVTPDARVSHLASPSFDASLFELTMAFCAGA
FT                   QVVLVPPPTYGGSALADILAVERITHAFITPTALATLEPTGLDSLRVLVVAGEPCPTDL
FT                   ARRWAPGRRMLDAYGPTETTIWSHVSEPLAPAEPVTIGRPVRGFTAAVLDARLHPVPPG
FT                   TPGELYLAGPGLARGYHDRPATTATHFVACPFAAPGWRMYRTGDLVRTRPDLTLEHLGR
FT                   TDFQIKVRGFRVEPGEVDSILAARADIGFAATVGRTGPDGEPILVTYVHGATGVDVDAS
FT                   AVRTALSAQLPPYLVPAAVVVLDEVPLTPAGKLDRSALPEPEFGPRPDRFRAPSTAVER
FT                   AVVEAIAEVVDIGEDRPIGVEDDFFALGGTSLSAVRVAADLQRRLGRPVPLPALFLDPT
FT                   PAGLAARLATEVPATTDEALRVLVPLRRGDRLAPLFCVHAGMGLAWAYTGMVRHLSPDR
FT                   PVWGLQLPSLGGGPEYDSIEDLAHRYLDEVRAVQPAGPYHLLGWSLGGLIAHAMATELQ
FT                   DRGEEVASLVLLDSYAGEPIAEPDPLDVGDLLRGLGVDVGPGANSRPLRYSDASDRLRE
FT                   AYGPAAAMTADQLRRIAEGYDRSTRLAARFAPRVFRGDALLLIAEDGPHDGWGDSITGT
FT                   VQEEHVDCGHNDMMQPKPARAIGMLVENYLSGRGR"
     gtggatacca ggaacaggag cgacgcgacc gttcgcagtc ggcccgacgc cttcccgctg        60
     acgcccgtgc agcgcggaat ctggctggcc cagcgcctcg cccccgacgt cccgaggtgc       120
     attgcgcagt acgtcgaggt gcgcggcgct ctggatctcg cggccctcga cgacgcgtcg       180
     gtcactgcgg gtcgtgagtt ccagtcggcg ttcctgcggg tgttcgagat cgacgggcag       240
     ccgttccaaa tcgtcgaccc gaccatcgag ctgtcgaccg gatatgtcga cctcggagac       300
     gagccggacc ccgtcgcggc ggcccacgcg tggatgacgc gggactacac cgcgccgctc       360
     gatccgacgc gggaccggct ggcgacgtcg acggtgttac aaatcggtga cgattgctac       420
     ttgtggtaca gcagaattca ccatgtcgca ctggacggtt acggagcgat gacgctggtg       480
     aaccgaatcg ccgccctgta caccgcgcgt gtggaggcac ggacgccgca acctgccggt       540
     gccgcagatc tgcgcaccct tcaccgtctc gacgaggagt atcggtcgtc gaggcactac       600
     gagtccgatc gggcgtattg gcgggaccgc ctcgccggtc tccgttccaa ctcgagcctg       660
     tcgccgacag tggcacccgc cgtcgcggac agcattctcg agaagaccct gctgtcgacg       720
     gccgcgacgg agcgactgga ccgttccggc gaacggctcg gcacgccgcc ggcgaccgga       780
     gtgatcgccg ccttcgccac gtatctcgcc cggatgaccg gacaagacga cgtggtcgtc       840
     gacctcccgg tgtcgggccg caccaccaca ctgctgcagc gatcgggcgg gatgctcgtc       900
     gggctcgctc cgctgccggt ggcaaccgca cccgacgaca ccgtggcttc cctcacccgc       960
     cgggtacacc acgaaatatt gggtgctctt cgtcatcagc ggttcacgct ggaggacatc      1020
     cggcgcgaga ccgacgcggc ggaatcgctg tgcgggccga tggtcaacgt catgctcttc      1080
     caccgccgga tccagttcgg accgctcacc ggagactttc acgtggtcac gtcggggccg      1140
     gtggaggatc tgctggtcaa tgtgtaccgc accaccgctg ccgggcggac ggtcatcgag      1200
     ttccgcggga acccccaccg ctactcccgg gacgaattgg ctcgtcacca tcggtcgttc      1260
     gtgggcctcc tcgaggagtt tctcgcggcg gatcccggcg atcccgtggc cgaggtgcac      1320
     acggagtccg cacatgaggg agatcggatc cacaggcgca cagcacatct ggactactgg      1380
     cggacgatgc tcaccgacct ggcccacgac acacctcttc cccgcgacca cacccgccga      1440
     gcaggtaccg tcgacggccg gcgagagcac gtcgaggcgc acgtgaccgc ggacctgcat      1500
     caccggatcg agaccctcgg acgggactgc ccgttcgcca cgtacaccgt cacgcatgcg      1560
     gccgtcgcgg cactgctcgc tcgtctcggc ggggtccgcg acgtcgtcct cgggacaccc      1620
     gcgggctcag gcggatggcc tctggttctg cgtatgcggg tcgacggcac cgaatcgttc      1680
     accgagctcg tcgagcgcgc acgtacgacc gaactcggtg cgttcacgca cgccgacgtc      1740
     agcttcgacg agatcgccgc cgcactcgcg attccagcag catctgcggg ccggcacccg      1800
     ttccaggtcg ggttcgactt gcagaccagc gatcaccctc acgaacccga cagccggtcc      1860
     gacgagggcg ccgacctctg gatccacatc gtcgaacatc ccggacgcgc cgggctcgac      1920
     ctccgactga ccttcgcgcg ggagcttttc gagccgtcga cgatccgcgg attcgccgac      1980
     cgtctggtcc gggtgctcga ccaggtcaca gcgcaccccg acatcccgat cgcggatctg      2040
     gacctgttga gttccgccga atggcgccgg ctcgtacccg cgcgcggcga tccgggagtt      2100
     ccgccgcgca cgctgcccga aatcctggca aatgcggcac accgcgaccc cgacgcgatc      2160
     gccgtcgtcg acgctgctgg tgacggtacc ggcatcacgt accgtcagct ggacgcggaa      2220
     tccacccagc tcgctcgcgt tctcctctcc cggggcgccg gccctgaaac cgtcgtcgct      2280
     ctcgcgctcc cgagatccgc tgatctcgtc cgcgccgtgt gggcagtcgc gaaatccggg      2340
     gccgccttcc tgcccgtcga tcccggatac cccgaagccc gcatcgcgca catgctcacc      2400
     gattccggtg cgaatctcgg ggtcacggtc agccgccacc ggggcgacct acccggtgac      2460
     gtcgagtgga tcgaactaca cgaccgcaac gccgacgaca ccacttccgt ccgcaccagt      2520
     acaccggtcg gcgacgccga ccgcccccgg ccgctgcggt gggaccaccc ggcctatctc      2580
     atctacacgt caggatcgac cggcgtcccc aaaggggtgg tggtgaccca ccgcgggatc      2640
     gcgaatctga tcgccgcaca gattaaaggg ctcgacgtgc cgcccaccgg gcgggtggcc      2700
     cagttcgcgt ccccgagctt cgacgcctcc ctgttcgaac tgctcgcggc tgtcggatcc      2760
     ggtgcgcgcg tggtgatcgt cccgcccgaa gtggtcgggg gtacggaact ggagcgagta      2820
     ctcaccgact atcaggtgac ccacgccgtc ctcactccga ccacgctcgc cacgctcgaa      2880
     ccacgtggcg cgccgaccct gtcgcatctc accgtcgccg gcgaggtctg cccgccagaa      2940
     gtcgtatcca catgggcgcc ggggccgcgc gtcgtcaacg cctacgggcc caccgaggcg      3000
     acgatcatgt cgaccatcag cgcaccgttg gtgccggatg agccggtcag cctcggagcg      3060
     ccggcatgcg ggttcgaggt cgtcgtgctc gacgaccggc tgcacccggt tccgccgggc      3120
     accgtaggcg agctgtacct cgcgggccca ggcctcgcgc gcggataccg aaaccgtgcc      3180
     ggactcgatg ccgtacgttt cgtggccgcg cccttcgggt cgccggggac gcggatgtac      3240
     cggaccggcg atctcgtgcg atggcgcgtc cggcacgggg aggatccatc cgctgccctc      3300
     gacctcgcct acgtcgggcg cagcgacttc caggtaaagg tccgcggttt ccgcatcgaa      3360
     ctcggggaga tcgaggcagt cctgcgtgcc gacccgagcg tggggttcgc tgtcgcaact      3420
     gccgcgaccg acccgaacac gggagatgcc gcggtgatcg cctacgttca cccggcagaa      3480
     gggcggcgcg tcgacgtcgg ggaaatgcac cgtcggctcg cgcgcacact gcccgcgcac      3540
     atgctccctg ccgcggtcgt ccccctcgac gtcattccgc gcaccccgag tggcaagctg      3600
     gaccgtgccg cgctcccggc gccgacgttc gccccgcgga gcggcgccgg ccaccggccg      3660
     cgcacgccaa cggaagagac ggtcgcgtcg gtgttcgaga ccgtgctcgg tgtcacgggt      3720
     gtcggtgtgg acgacgacta cgtcgatctc ggcggaggtt ccctggcggc gacccgggtg      3780
     gtggcacggc tgaattccgc cctggaaacc tcgctggacg tccgtgatct cttcgagcac      3840
     ccgacggtcg ccgcactcgc cgatatcgtc gagagccggc gcggcgatgg ctccgagcgg      3900
     cctcccctcc gccggttccc ccgccccgcc aggattccgc tctccccggc gcaggaacgg      3960
     atgtggttcg tcaaccagta cgacccgcac tccccggcct acgacattcc gctggtcgtc      4020
     cggctcaccg gtcacctcga cgtcggtgcc ctcgaagcag cgatcgcaga cgtcgtcgaa      4080
     cggcacgagt cgctccgcac ggtgtacccg acctcggacg acggaccaca tcaggtgatc      4140
     ctgcccgcgg aacgggcgct gccccgggtc gagaccgtgc gggtcgacgg tccgaccggc      4200
     ctcgacgcac acgtcgccgg ggccgcggcc gcgccgttcg acgtcaccgt cgacgcgccg      4260
     ctccgagcat ctctgttcac gatcggtgac accgaccacg tgctggccct ggtgatccat      4320
     cacatcgcgg ccgacggtgc gtcggctggt ccgctcgctc gtgacctctc cgccgcctat      4380
     cgtgcccggg tcgagggacg cgcccccgcc tgggaaccgc cggccgtgca gtacgtggac      4440
     tacgccttgt ggcaacacgc actgttgggt cggcccaccg atcccgacag cctcgcgtcg      4500
     cggcaactcg actattggag tgagtcgctc cggggatcgc cgccccttct cgcgctgccg      4560
     accgaccgtc cgcgcccaca gcggcggtcc ctgcacggcg gccgagtgga cttccacctg      4620
     cctccggagt tgcacgccgg catgcgggca ctgtcccgaa cctgcacgtc cacactcttc      4680
     atgacgtgtc acgcggcgct ggcagtcgtg ctcgcccggc tcgccggcac ctacgatgtg      4740
     agcatcggca ccccggtcgc gggacgtggg gagcccgcac tcgacgacgt ggtgggcatg      4800
     ttcgtcaaca cgctcgtgct gcgcacccgc atcgatcccg aggcgggctt cgcggacacc      4860
     gtacgcactg tgcgggatgt ggacctgggc gcgttcgcac acgccgacta tccgttcgag      4920
     aagttggtgg actccctcga acccgaacgc acggacagtc gttcaccgtt gttccaggtt      4980
     cttctcgagt tccagaacgt cctgcctgcc ggacacgagg cgcgggagct cgacctgccc      5040
     ggtctgcacg tcgcggccgt cggctacgac ccgaagatct gtaaattcga cctgcaggtg      5100
     tggctcagtg aacgccgcga tgacggcggg gcgccgcagg gaatcgacgg cagaatcgta      5160
     tacgccaccg atctgttcga cgaagagacg gtgcgtgggc tcgccgaccg gctcgtccgc      5220
     gtcctgaata tcgtgaccac ggagccggac accgtggtgg ggaacatcga tctgctcacc      5280
     gaccgggaac gtgacgtcgc cctccgttcg tggaccgcac cggacgaacc gggccccgcg      5340
     acgacgctgc ccgcggagtt tgcccggacg gcggcacggc aaccagacgc cgtcgcggtg      5400
     tcgttcgcgg gtgacacgct gtcgtacggc gaactcgccg accgggtgaa ccgaatcgcc      5460
     cggctgctcc acgatcacgg agcggaaccg gaacgcctcg tcgccgtggc gattccccat      5520
     tcgatggact acgtcgccgt cacactgggc gtgctcgcgg caggcggcgc gtgcctacca      5580
     ctcgatcccg gatgggcgtc gcccacgcaa acctcccgga cgatccctga catcgcgata      5640
     tttgtgacga tatccgctgt ggaagaacat cttccccacg gtcacgttcc caccctcgtc      5700
     ctcgacgcgc ccggcaccgt cgccgacctc gcgcgcaggt cgggtcaccc cctcaccgcc      5760
     gtcgacgtcg gcgccggtcc cagcccggac accgccgcct acgtcctgct cacacgcggg      5820
     tcgaccgcgc tgccgaaacc ggtatcggtg actcaccgcg cagtgctgtc ggcactggca      5880
     cgtcccgccg tcccggccgg cgaggtctgg gcaatggtcc cgaccttcgc gccgggcgtc      5940
     accgtcctga ccccgtggag cgcattcctc catggaggtc ggctggaggt ggtcgacgac      6000
     gccactgcct ccgcaccgtc cgccctggcc gacctgttgc accgccgcgg cgtgaacatg      6060
     gtcgcccaga ccccggccgc gtacgagcac ctgtcccgag caagggaatc cgcgccggcg      6120
     gcggacgaac ttcgctcggt cctgctcacc ggtgaccccg tcgacgccgc ggtcgtggct      6180
     gcccctgaag ttgtcgccgt ctacgcgtcc gtggaggccg tctggttcgc cgccgccacc      6240
     gatcgtgcac cggaagccgg tgccgaccgg atggaatacc ggcccgcgcg aggacgaaga      6300
     ttcgcggtcc tcgacgaccg cctcgcgcct gtcccacccg gcgtcgtcgg tgagttgtac      6360
     atcggtggac ccacgctcgc tcgtggctac catcgccggg ccgcagcgac gagcacccac      6420
     ttcgtggcga gtcccttagg cccgcccggc gaacgcatgc tccgcaccgg cgatgccgct      6480
     tgcctcacgc cgaccggagg cctgaacatt ctgtggcgcc gcgatttcca gtccgaactg      6540
     cgcggatacc gcatcccgct cggcgacatc gacaccgtcc tcaccgcgca cccgcaggtc      6600
     gcgaatgccg tcaccgtcga ccacacccct cgcgccggaa agcccgccct tgtgacgtat      6660
     gtcgtgccgg cacccggatc gacgacgacc atctccgagg tccgcgccca cgccgccatg      6720
     atcttgcccc cgccctgggt cccgggcgcg gtcgtcgtcc tcgaccgact gcccgtcacc      6780
     gagacggggg acgtcgacct cgacgccctt cccgttcccg aggagctgcg gcacgcaccc      6840
     gtctaccacg ccccggccac cccgaccgag aagacggtgt cgagggtgat cgcccaggtt      6900
     ctcggtatcg gtggcgtcgg tgtcgacgac aacttcttcg aactgggtgg cacgtcgctc      6960
     gacgcggcga aagtggtcgc ccgaatcgat tcggcgttcg gaaccaggat cggaatccgc      7020
     tccctcttcg aggcgcccac ggtacgcgga ctcgccaccg tcctcgatgc gagcgaggtg      7080
     cacccggaca gacccgccct gggaccacgg gcccataccg aacccgcacc ggtgtcgttc      7140
     gcgcagcagc gtatgtggtt cgtcaaccag ttcgacgtga cgtcggccgt ctacaacgtt      7200
     ccgatggtgg tccggctgac cggtctcctc gacgtccccg cgctacacgc tgccctgatc      7260
     gacgtcctcg tgcggcacga accgttgcgg accctctacc ccttgaccga caccggaccg      7320
     gtgcaggtcg tcgtccccgc cgagagcgtg ccggtcgatc tggcaccgat tcccgtggcc      7380
     gacgcagcgc gtgtctccgg cctcgtcgac gaagtcgtcg ccgaggggtt cgacgtcacg      7440
     gtccgtccgc cggtacgcgt ccgactgtgg caactcgacg accacgccca tgtcctggcc      7500
     gtcgtcgtgc accacatcgt cgccgacggg tcctcgctgg ctcccctggc gcgcgacctc      7560
     tccaccgcgt acaccgcgcg ccgcgtcggc cgtgctcccg tgtgggagcc gttgcccgtc      7620
     cggttctcgg atttcgcggt gtggcagcgg gaggtcctcg gatccgtgac caacccggcg      7680
     tcgccggtgg cacggcaact cgacttctgg cgcacggcgc tcgccgatct tcccgaacgg      7740
     ttggagttgc cgctggatcg gccacgtccc gccaccgcgt cgtaccgggc cgcagcggtg      7800
     ccgttcgtga tgcccgaaag gacgcaccgc cggctcatcg acttcgcccg tgcccacgac      7860
     acgacgactt tcgtcgtcat ccacgcggcc ctggccgtat tgctgtcccg gctcgcctcc      7920
     accacggacg tcgtcgtcgg atcgccgacc gccggccgcg gcgaacagac actcgatccc      7980
     ctggtcggta tgttcgtcgg cactctcgtt ctgcgcacga ccgtcgatcc ggcgtcaccg      8040
     ttcggtgccg tcgtggcggc ggtgcgcgac gccgatctgg cggccttcgc gcacgccgac      8100
     atcccgttcg aaaccctcgt ggacgaactt cacccaccgc gttcggcggc ccttcatccg      8160
     ttgttccagg tcatgctgtc gttccagaac atcgagccac catgcctcgg attgcccggc      8220
     ctcgaggctc atgtcacgga cctcgagccc cgggtgtcgc cgttcgacct gaatgtggtg      8280
     gtgcgtgaac aaccggccga ggacggttcg cttacgggta tcagcgggca gatcgtctat      8340
     gccaccgacc tgttcgacgc cggcacgatc cgtgccttct ccagccggct ccttcgggtg      8400
     atcaccgccg ccctgacgaa tcccgagacg gtggtgggcg acgtcgacat cctcgacgac      8460
     gccgaacgcg ggctcgtcct cgaccggtgg aacgccacgg cccacgacct tccggccacg      8520
     acgatcgtgg acctgttcga ggcccaggtc gctgcgacac ccgatgcccc ggccgtccgc      8580
     ggggaggatc gaatcctcac ctacgccgaa ctcgacacct ggtccacccg gctggcgcac      8640
     tccttcctcg cacgcggcat cggcaccgaa tccatagtgg ccctggtcat cccgcgatcc      8700
     gtcgagatgc tcgccgcaat gtacgcggtg gtcaagtccg gtgctgcggt gctcgcactc      8760
     gatcccagcc accccaccga ccgcatcgaa tcactgatcc aatccgcgtc ggcggctctc      8820
     gtcgtcacca ccggcgacgc cgatgtaccc gttcccaccg gacttccggt ggcacggttc      8880
     gacgacatcg accacgaggc ccgagacaca gcaccagtga ccgacgtgga ccgcggcgca      8940
     tcactgcacc ccgacaacct ggcctacgtg gtctacacat cgggctcgac cggcgcaccc      9000
     aaaggcgtgg cggtatccca cgcggcgata gcgaatcagc tggcctggtc gcaggcacag      9060
     ctcccgatac acgagcacga ccgcaccgta cagaaggcgc cgatcgcctt cgacgttgcc      9120
     atctgggagt gtttcgcggc tctgtgttca ggaagcgtcc tggtcctcct gccgccggat      9180
     cggcagttcg acctcgacta tctgtccggc ctcctcgacg acatgcagat cacagtggtg      9240
     gagttcgtgc cctccctact cgacgtgttc gtcaacgatc atcggcactc cttcccaggg      9300
     tccctgcgcc gggtcctgac cgggggtgag gcgatcagtg cacggacggc gagcagcgtg      9360
     ctcgcgcagg gtgtccgcct cggcaacatg tatggtcccg cggaggcggc cgtgacagcg      9420
     acgtaccacg acgtcgcagc cgctcgagct gccaccactg tgcccatcgg gtcgccggtg      9480
     tggaatacac aggtgtacgt cgtcgacggt cggctgcacc ccgtcgtccc cggggtgacc      9540
     ggcgaaatgt atctcggcgg ggctcagttg gcgcgggggt atctcggcag gcccgggatc      9600
     acggccggac ggttcgtcgc gaatccgttc ggcgccccag gctcccgcat gtaccgaacc      9660
     ggagacctgg cccgctggaa ccccgatgga cagctggact accacggtcg caccgacttc      9720
     caggttcagc tccacggcta ccgcgtcgag cccggcgagg tcgaatccgc cctcctgcgt      9780
     caccccggga tcgcgcaggc cgtggtagtg ccgcgagccg atcgcaacgg cgcacaccac      9840
     ctcgtcggat atgtcgtccc cgtccccggc atcgacgtag cagaggagga actgctcgat      9900
     cacacgaggt cacttcttcc ctcgcacatg gttccgtccg cggtgatctc actgtccacg      9960
     ctgccgttga cgccccacgg gaaggtcgac cggaacgcgc ttccgatcgt cgacttcacg     10020
     acccgcgccg cggaattccg ctcggccgga acagctgtcg aagagtcgtt ggtaaccctc     10080
     gtccgcgacg tgctcggcct cgagtccgta ggtgtcgacg actcgttctt cgcgctcggt     10140
     ggcgacagca tcatggcgat ccagttggtg gcacgcgcga agaccgccgg gctggcactc     10200
     actccgcggg atgtgttcga gtacaagacg atcgcccggc tcgcgcgcgc gatctcgaca     10260
     cggccggaac cgcgcgcggt cctctccgaa cttccgggcg gagggatcgg ctccttcccg     10320
     ctgccaccgg cggcgcggtg gttgctcgag cgcgggggcg acctcgacac gttctgccaa     10380
     tcggtcctgc tcaccgcccc acccgacctg aacaccgaca ctctcaccgc caccgtgcag     10440
     acggtcctcg accaccacga catgcttcgg gcccggctcc ggcgcgggac aacggacgaa     10500
     gacacggtgt tggaggtcgt ggccgcccac caggctccac gggtcgagtc gctgatccgc     10560
     cgggtcgcac tcgatgatcc ggccgacctg aagggccggg ccgaggtcga gtcccgtgct     10620
     gccgccacac gtttggatcc cgagaacggg atcatgctcc aactcgtctg gctcgacccc     10680
     cacacccaac ccggacacct cctcctcacc atccaccacc tcgccatcga cggcgtctcc     10740
     tggcgcatcc tcatccccga cctcgccacc gcccaccacg cccacaccac cggcaccacc     10800
     cccacactcc cacccgtcac cacaagcgcc cgccgctacg cccacgccct caccgacacc     10860
     accacccacc acacccacga actcccccac tggcgcacca tcctcaccac ccccgacccc     10920
     ccactcggca ccagacccct cgaccccacc cacgacaccg aacacaccac cacccacacc     10980
     accaccgaac tcccacccca caccacccac accctcctca ccaccctccc caccacctac     11040
     cactgcggca tcgacgacgc cctcctcacc gccctcgccc tcgccgtcac cacctggcgc     11100
     caccgacacc acacccccac ccacaccctg ctcgtcacca tcgaaggcca cggccgcacc     11160
     aacacccaca tccccggcgc cgacctcacc cacaccctcg gctggttcac caccatccac     11220
     cccgccctcc tcgacctcac cgacatcgac ctccacgacg ccctcaccgg cggacccgcc     11280
     accggacacg ccctcaccac catcaaagaa caactccaca acacccccga ccacggcacc     11340
     ggatacggcc ccctccgcta cctcaacccc cacaccgcaa cacaactccg caacctcccc     11400
     caaccccaaa tcaccctcaa ctacctcggc cgattcgact acccgccgtc acgtccggag     11460
     gcgggctgga tgcccgtgac ggatgtggat ctcagccgac gacccgactc ggaccttgct     11520
     gctgcagccg tcctgacaat cgatgccgcg acggtcgtca cggagggcgc tgcacggctg     11580
     acggctacat ggtcctacgc cgccggtgtc cttgccgcaa ccgatgtcga cgacatcacc     11640
     gagctgtgga ccgaagcgct caccgccctc gccgaccaca tcagccgacc cggcgccggc     11700
     cggctcaccc ccagcgacct cgacctcgtc cacctcgacc aacccgccct cgacgcactc     11760
     caccaccact accccaccct caccgacgtc tggcccctca cccccttgca ggccggtcta     11820
     ctgttccacg ccgaactcgg cggccccgct gccgacgcat acgtcgtcca actcgtcctc     11880
     gacatcagcg gacccctcga cgccgaccgt ctacgcgacg ccggggcagc cttgctcggt     11940
     cgtcatccga acctgggcgc ggccttcact cacacggcgg acggcacacc ggtacaggtc     12000
     gtgacgacca ctgctctcgc ctgggcgcac cacgacgtca ccaccgcaca ccgtcccgcc     12060
     gcagaactcg gcgacatcgt caccgcggac cgcgccgcgc cgttcgaccc ggccgagccg     12120
     cctctcctgc gattcaccct cgtgacgacc ggccccgacg accaccatct ggtgctcacc     12180
     aaccatcatc tggtactcga cggctggtcc accccactac tgctgcacga acttctccag     12240
     ctctatgaga gccacgcgga tcccgatgcg cttgcgccgg tgcggccgta ccgtgatttc     12300
     ctcgaatggc tgggcacacg cgacgtctcg gcgtccgtcg ccgcgtgggg tcgtgcgctc     12360
     gagggtgtcg aggacgctac gcggctcgca ccgggcctcg aacctcaccg ggatccgggt     12420
     ccctgcgcgg agcgcgtggt ggcactgacg gccgccgaga cggatgcgtt gcggaccgtg     12480
     gcccgcaccc acgacctcac cctccacacc atcatcgaca ccgcctgggc cctcgtcctc     12540
     gccacccaca ccggcaccac cgacatcacc ttcggcacca ccgtctccgg acgcccaccc     12600
     cacatccccg gaatcgaaac catgatcgga ctcttcatca acaccatccc cgtccgcatc     12660
     accctccacc ccaccgacac cctcaccacc ctcctcaccc gcacccacac cacccacaca     12720
     caactcctcg accaccacca cctccccctc acccacatcc ccaaccccca cgccaccacc     12780
     ttcgacacca tcaccgtcca cgagaactac ccccaccaca ccaccacccc acccaccgac     12840
     ctcaccatca ccaccacctc cgccaccgac gccacccact accccctcgc actcgccgcc     12900
     accaccgaca ccacactcca cctgcggggc atcttccagc tgtcggcatt cgacgccgac     12960
     agcgtcgacg cgatcctcgg acaactggcg cgtgtgctcg tcgccatggg atccgacgcg     13020
     tccctgccga tcgcccgcct gaaccttctc gatgctgcgg agcagcgagc cgtggtgccc     13080
     gccctgggtg aggcggccga cgagccgcgg accctgggcg cgatcctcgg ggacgccgcc     13140
     gagcgctcgc ccgacgccgt cgccgtagac gacggggccc gccggctgac gtatgccgaa     13200
     ctcgaggccc gcgcattgct ccttgccgac cgtctcgtcg agtcgggtgt gggtccggaa     13260
     agtgtggtcg ccatcgcgat accgcggtcc ctcgagtcag tcctcgcagt ctgggccgtc     13320
     gccggaaccg gcgccgcgtt cgtgcccgtc gacccgacgt atccgcagat ccgcatccag     13380
     cacatggtcg ccgattccgg agtcctcgtc gggctcacca cgagcagtcg tcgcgacgcg     13440
     ctgccggaca ccgtcacgtg gatcgacatc gagggcacgg gtgccggccg gctaccacac     13500
     gccggtgttt cggaggcttg tccggcgcca acgatccgcc ccgacaacgc ggcgtacctg     13560
     atctatacgt ccggctccac gggggttccg aaaggtgtgg tggtcggtca tcgtggagtg     13620
     aactctctcg caaccacgtt gcgcgagtgt accggggtga cagcagcgtc ccgggtggcg     13680
     catttcgcgt ctcccagctt cgacgcgtcg gtactcgagt atctgctcac gtggtccgcg     13740
     ggagccacgg cggtgatcgt gcccaccacg atctacggcg gggatgaact gcgtcggcat     13800
     ctcgccgaca gccgggtgac ccatgctttc ctgaccccca cgacgctgac tgccctggac     13860
     ccggacggcc tggacgacct cgagtgcgtc gtgaccggcg gtgagaagtg cacccccgag     13920
     gtgattcgcc ggtggtctcc gcactgtcga ctcatcaacg cgtacggacc gacggaaagt     13980
     accgtagcgg cggatatttc ggacgatccg gccgccgacg gtgcgaatgt gatcggcggc     14040
     ccgatccgcg gcgtcaccga ggtcgtactc gacgctcgaa tgcaaccggt cccgatccgg     14100
     gcccggggcg agttgtacat cgcgggtgac gcgatcgccc gcggatacca cggcaagccc     14160
     gcactcaccg ccacccgttt cgtggccgat ccgttcggcc caccgggcgg tcgcatgtat     14220
     cgaagcggtg atgtcgtccg ctggaacacc ggacgcgaag ggtctgccgt cctcgagtac     14280
     ctgggtcgca ccgactctca agtgaaggtg cgggggtacc ggatcgaacc cggcgagatc     14340
     gacgcggtgc tgtccggtca tccggcggtc acgttcagcg cgaccctccc ctcgacgggc     14400
     ggcccggaca cgaccgatca ggacgcgaca ctgatctcct acgtgacgac cgccggtgcg     14460
     gccgggcccc gagaactccg cgactacctg gccggtcggc ttcccgcaca gctcgttccg     14520
     tccgcggtca tcgagatcga cgtggttccg cggacgccgt cgggcaagct cgaccgcgac     14580
     gcactccgcg ccctccgatc caccccgctc cccgcgcagg tgtcggcggc caacccactc     14640
     gaacagaccg tcgcggaaac cctcgccgcg gcactcgacc tgtcgagtct gggagtggac     14700
     gacgacttct tcgcggcagg tggagactcg ctgacggcga cccgggccgt cgcccgtgtg     14760
     aacacgaccc tgcataccga cctcgccgta cggagcctgt tcgaggcccc cacgccgcgc     14820
     gctctggcgc ggctgctcct ggacgacaca caatcggagc cgcgcccccc gttgaccgcc     14880
     gccgcgcaag aaccggagta cgcaccgctc tcgcctgccc agcaacgcat ctggttcctc     14940
     aaccaatacg acaccaccac ccccacctac aacatccccc tcaccctcca cctcaccggc     15000
     cacctcgaca ccaccgccct ccaccacgcc ctcaccgacc tcatccaccg ccaccaaccc     15060
     ctccacacca cctaccccct ccaccacgga caccccaccc aacacatcca cccccacccc     15120
     acaaccccac cactcacacc cacccccacc accgaaaccc aactccccca ccacatcaac     15180
     accgacacca cccaaccctt cgacctcacc accgacaccc ccctccacac ccacctctac     15240
     caactcgaca acacccacca caccctcacc ctcgtcctcc accacatcgc cgccgacggc     15300
     cactccctca ccccactcac ccacgacctc accaccgcct acaccgccca cacccaccac     15360
     caaccacccc accccacacc cctacccctc acctacaccg actacaccca ctggcaacac     15420
     caactcctcg gcacacccca acaccccacc cccaccaccc acacccaaac cacctactgg     15480
     accaccacac tcaccaacct ccccgacacc ctccccctcc ccaccgaccg accccgaccc     15540
     acccaccgca cccaccacgg ggagtccatc cgcttcgaga tccccgccga cgtacaccac     15600
     cgcctgcgtg cgctggcgcg gagtaccggg gcgaccacgt tcatgactct gcatgcggcc     15660
     ttcgccgcgc tgctcgcgcg cctgtgcgac acggacgacg tcgtcatcgg cacccccgtc     15720
     gccggccgcc ccgatccccg gctggaccaa ctcgtcggca tgttcgtcgg gacgctcgtc     15780
     ctccggaccc cggtcgactc ggccggttcg ttccgcgaag tcctgaccag aacccgcgac     15840
     gcggacctcg gtgcattcat gcacgccgac ctgcccttcg agatgcttgt cgacatcctg     15900
     gcaccggagc ggtccacgac gcacacaccg ttgttccagg tcctgatcga ctatgggacc     15960
     gaggtaccac tccacctcga actgccggac ctgacggtaa cggtcgccga ggacactccg     16020
     cccctcgcga agttcgacct tcagctcacc ctccgcgagc atgcggacgc cgcgaacccc     16080
     ggcctgtcgg ccgcgttcac ctatgccacc gacatcttcg accgcaccac cgtcgagggt     16140
     gtcgccgcgc gcttcctccg gctcctcgac tcggtgaccg cggaccccgg ccggccagtc     16200
     ggggacgtcg acctcctcga cgccaccgaa cggaccgcgc tgacgaccgg gtcgagcaca     16260
     ccttcgccgc cggcggagcc agtcgaggcc atactcgccg accggttcac tcggtccgtc     16320
     cgccgcttcg ccgacgaatc ggcgctgacc gataccggcg aaacgctcac ctacgcggca     16380
     ctcggtgccc gcgtctaccg actcgcccgg catctcgtcg aactgggcgc cgcccccgac     16440
     acggtcgtcg ccgtagcact gccaccctca atcgatctgg tcgtcgccct gctggccgca     16500
     cagcaagcgg gagccggcta cctcgccctc gacgtcggtc acccggccga ccggctcgac     16560
     gccacgatgt ccgacgccgc cccggtgtgt ctcgtctcca cgaccgacca cgcggcccga     16620
     ctgcggcgga accttcccac cgtgctcgcc gacgacgcgg acacacgcgc acacctgctg     16680
     gatctgtcgc cggatccgat caccgatccc gagagacggg ccgcgctcac ccccgacgcg     16740
     gtcgcgtacg tcgtgtacac gtcggggtcg accggacgcc cgaaaggtgt cgtggtgaca     16800
     caccgtaatc tcacgacact gttcgacaac acccggactg cgttcgattt cgccgagacc     16860
     gacgtgtgga cgctcttcca ctcggccgcc ttcgacttct cggtatggga gttgtggggc     16920
     gccctcctgc acgggggccg actggtcatc gtcgacaccg tcaccgcccg cgcacccgac     16980
     gagttcctga gcctgctccg ccgcgagcgg gtgacggtcc tgtgccagac tcccaccgcg     17040
     ttcgcccagt tggccacggc ggaacggaac cagccgaccg acctggcgtt gcggtacgtc     17100
     gtcttcggcg gcgaagccct cgagcacggt cacctcgtcg actggctcga ccggcacgat     17160
     cacacccgac cccagctcgt gaacatgtac ggcatcaccg agaccaccgt gcacgtgacc     17220
     aggcatcccc tcggcgaccc tcgtcccgct gcgcggtcgg tcatcggccg ggcgattccg     17280
     ggactgcgcg tgtacgtcct cgaccggcgg ctccacccgg tacccaccgg agtgaccggc     17340
     gagatgtacg ttgccgggaa ccaggtcacc cgtgggtacc tgcaccgatc cgggctgacg     17400
     gtgacccggt acgtggcgga cccggccggg cgcggaggac gcatgtatcg caccggtgac     17460
     ctcgcacgct ggaacgcgca gggccaactc gagttcctcg gacgtagtga cgcccaagtt     17520
     cagctacacg gctaccggat cgagcccgga gaggtcgagg ccacgctcgt ccgccacccg     17580
     gatgtcgcac aggccgcggt gtcggtccgg cccgacgacc gaggcaccga gcgcctgatc     17640
     gggtacgtcg tacccgtccg ggacggtgaa cagacgaggg ctgtcgacat cgatcgggtc     17700
     ctcggcttcg cccgaacgat tctcgcaccg cacatggtgc ctgcgacgct cgtggtcctg     17760
     gaccgcctgc cgctgacccc gaacggcaag ctcgatcgcc gacagttgcc cgcacccgac     17820
     ttcgccgaac gcgtctctac aggtcgcgcc ccggtgaccg cgagcgagtt ggccctcgcc     17880
     gagatttttg cggaggtcct cggcgtgccg tccgtgagtg ccgacgagtc cttcttcgca     17940
     ctcggtggcg acagcatcat ggcgattcag ttggtgtccc gcgcccacga ggacggtgtc     18000
     ttcgtcactc cccgagacat tttcgagcac cagaccgtgg ccgcactcgc cgaggtcgcc     18060
     gccaccgtga agcaggacgt gctggccgag cttcccggcg gtggcgtcgg gaccgcaccg     18120
     ctcgtgccga tcgcgcggtg gttgctcgag cgcgggggcg acctcgacac gttctgccaa     18180
     tcggtcctgc tcaccgcccc acccgacctg aacaccgaca ctctcaccgc caccgtgcag     18240
     acggtcctcg accaccacga catgctccga gcccgactcc ggcgcggaaa aacggaccag     18300
     gacaccgtcc tcgagatccc accggccgga acaatcgccg ccgcacccct catcacccac     18360
     gtcgcggtcg agacgcactc ggacaacgac ctcgccgcga cggcacgcgc gcaactcgac     18420
     gccgcaacgc accgactcga tcccgagaac gggatcatgc tccaactcgt ctggctcgac     18480
     ccccacaccc aacccggaca cctcctcctc accatccacc acctcgccat cgacggcgtc     18540
     tcctggcgca tcctcatccc cgacctcgcc accgcccacc acgcccacac caccggcacc     18600
     acccccacac tcccacccgt caccacaagc gcccgccgct acgcccacgc cctcaccgac     18660
     accaccaccc accacaccca cgaactcccc cactggcgca ccatcctcac cacccccgac     18720
     cccccactcg gcaccagacc cctcgacccc acccacgaca ccgaacacac caccacccac     18780
     accaccaccg aactcccacc ccacaccacc cacaccctcc tcaccaccct ccccaccacc     18840
     taccactgcg gcatcgacga cgccctcctc accgccctcg ccctcgccgt caccacctgg     18900
     cgccaccgac accacacccc cacccacacc ctgctcgtca ccatcgaagg ccacggccgc     18960
     accaacaccc acatccccgg cgccgacctc acccacaccc tcggctggtt caccaccatc     19020
     caccccgccc tcctcgacct caccgacatc gacctccacg acgccctcac cggcggaccc     19080
     gccaccggac acgccctcac caccatcaaa gaacaactcc acaacacccc cgaccacggc     19140
     accggatacg gccccctccg ctacctcaac ccccacaccg caacacaact ccgcaacctc     19200
     ccccaacccc aaatcaccct caactacctc ggccgattcg actacccgcc gcacgggctc     19260
     tcgaacggtg ccggctggga accgataacc agcatcgagt tcgacaccac gattctcgga     19320
     aacgtgcccg tcgcagcgat tctcgacgtc aatgcctacg tctacgagtc agggggcgcc     19380
     ccgatcctgc gcaccacctg ggtgtatccg cccggtgtgc tcccggcggc cgacgtcacc     19440
     gagctcaccg agctgtggac cgaagcgctc accgccctcg ccgaccacat cagccgaccc     19500
     ggcgccggcc gactcacccc cagcgacctc gacctcgtcc acctcgacca acccgccctc     19560
     gacgcactcc accaccacta ccccaccctc accgacgtct ggcccctcac ccccttgcag     19620
     gccggcctgc tgttccacca cgaattgacc agccaggacc tcgacaccta cgtcgtgcaa     19680
     ctcgtcctcg acatcgacgg ccccctcgat cccgaccgtc tccgcgacgc cgcggacgcc     19740
     ttactcggcc gccacccgaa cctccgcgcc gccttcggac acactcccga cggcaccccg     19800
     attcaaatca tcactcctgc aatacttccc tggaatcacc acgatctcag cgacgagcgc     19860
     gacgggacgg tcgctcacga catagtcacc gccgaccgca ccaccgcgtt cgacctgacc     19920
     gcgccacccc tgctccggct cacgctcatc acccacggac cgacccacca ccaggtcgcc     19980
     ctcactcatc accacatcct gctcgacggc tggtcgacgc cccttctcct gcacgaactc     20040
     ctccagttgt acgagcacca caccgacccc ggcgctgtgc ctcgacccct cccgtatcgc     20100
     cgctacctgg agtggctcac ccagcagtcc ctcgaggaga gccgggccgc gtgggccgac     20160
     gtcctcgacg gactggaagg accgacgatc ctggtgccgt ccgcacgcgg ccgcgtccca     20220
     tccactttcc ccgaggagta tcgggtctcg ctgtcaaggg agcacaccga tgcgttgcgg     20280
     acggtggccc gcacccacga cctcaccctc cacaccatca tcgacaccgc ctgggccctc     20340
     gtcctcgcca cccacaccgg caccaccgac atcaccttcg gcaccaccgt ctccggacgc     20400
     ccaccccaca tccccggcat cgaaaccatg atcggactct tcatcaacac catccccgtc     20460
     cgcatcaccc tccaccccac cgacaccctc accaccctcc tcacccgcac ccacaccacc     20520
     cacacacaac tcctcgacca ccaccacctc cccctcaccc acatccccaa cccccacgcc     20580
     accaccttcg acaccatcac cgtccacgag aactaccccc accacaccac caccccaccc     20640
     accgacctca ccatcaccac cacctccgcc accgacgcca cccactaccc cctcgcactc     20700
     gccgccacca ccgacaccac actccacctc aagttcgagt ttctgccgga gttcctcagc     20760
     cgcaaggaca ccgaggcgat cgcggcccac atgtgccggg cactggacgt catcgcgacg     20820
     gcaccggaca cgaccgtggc gtcggtgcgg cttctcggcg acgacgagtt ccgtgcgctc     20880
     gcgcccgtgc gcggcggtcc cgcacccgcc acccgcacgc tcgcgacgat cgtcaccgac     20940
     gccgcagccc tcgatccgga cgccgtcgcg ctcgaagact ccggtcgcgc tgtgagttac     21000
     cgcgacctcg acgaggcgtc gaaccggctc gcgcgcctgc tgatcacgcg tggcgccggc     21060
     ccggagcgct acgttgccct ggcgattccc cgttccgccg actccgtgct tgcggtctgg     21120
     gcgatcacca agaccggggc cgctttcgtc ccgatcgacc cgggttatcc cgccgcacgc     21180
     atcaccgaca tgatcgccga ttcgggtgtc gcgctcggcg tcacactgac accgcaacgt     21240
     gagcggctgc cggccacggt gccatggctc gtcctggacg aacccgggac ggtcacgatg     21300
     gtcgaacaac agccgagcgg cgccgtcggt gatgccgatc gccgccggcc attgcgaccc     21360
     gaccatcccg catacatgat ctacacgtcc ggatcgaccg gtgtcccgaa gggcgtggtg     21420
     gttccgcacc gcgggctggc cacgctcgct gcggcgcagg cggccggcct cggtccgggg     21480
     cggcactcgc gcgtgctcca cttctcgtca ccctcattcg acggatcggt gttcgactat     21540
     ctactggcgt tcggctgtgg cgcgactctg gtgatcagcc cgccgacaat cgtcggcggc     21600
     acggagctgt cccgcttcgt cgccgccgaa cgggtgacgc atgccttcgt cccgactgcc     21660
     gcactagcct cggccgatcc cgatgatctc gacggatacg acgggttcgg cgagattctc     21720
     gcggccggag aagcgtgtcc gcccggtctg gtgacccggt ggtcccgtgg ccgtgctctg     21780
     cggaacggct acggccccac cgaaaccacc gtgatgtcca acatcagcgc gccgctcgca     21840
     cccgggtccg acgtgacgat cggcggcccg atcgccggtg cggaggaagt ggtgctggat     21900
     gcgcggctgc aaccggtccc ggacggcgtt ccgggtgagt tgtacattgc cgggccgggt     21960
     ctggcccgcg gataccaccg gaggccgggg ctgaccgcag gacgcttcgt cgccgctcca     22020
     tacgggccgg cgggcgagcg gatgtaccgg accggcgaca tcgtccgctg gatcgccgac     22080
     acgtccggcg gtcgggtggt cgagtacctc ggccgcgccg acttccaggt gaaagtgcgc     22140
     gggttccgca tcgaacccgc cgaggtcgac gccgtcctcg gtgcccaccc ggacgtggaa     22200
     tacgccgcga cactcacccg caccggaccc gccggggacc cgatcctcgt ctcctacgtc     22260
     gtcggttccg cggaactcgc cccggcacta ctctcggcct atctcaccga acgacttccg     22320
     gctcacatgg tgcccagcgc gatcgtgccg atcgaccgga tcccgctgac ccccgtcggc     22380
     aaactcgatc gcgccgaact gcccgatccc cggttcgact ccccggccga tcccgcccac     22440
     cgaccgacgt cgcccgtcga ggagaccatc gcgaacgcat tcgcggccgt tctggggctc     22500
     gagcacgtcg gtgtcgacga caacttcttc gaggcgggcg ggaactcgct gacggcgaca     22560
     cgggtcgtgg cacgggtcaa ttcgacgctg cacacccaca tcgacgtccg gaccttgttc     22620
     gaggaccgga caccgcgggt cctgtccacc cacctcgacc acgactcgaa cgacgccccg     22680
     ctgccggtgc ccactccggg gccccaaccc gagttcgtgc cgttatcgcc cgcccagcaa     22740
     cgcatctggt tcctcaacca atacgacacc accaccccca cctacaacat ccccctcacc     22800
     ctccacctca ccggccacct cgacaccacc gccctccacc acgccctcac cgacctcatc     22860
     caccgccacc aacccctcca caccacctac cccctccacc acggacaccc cacccaacac     22920
     atccaccccc accccacaac cccaccactc acacccaccc ccaccaccga aacccaactc     22980
     ccccaccaca tcaacaccga caccacccaa cccttcgacc tcaccaccga cacccccctc     23040
     cacacccacc tctaccaact cgacaacacc caccacaccc tcaccctcgt cctccaccac     23100
     atcgccgccg acggccactc cctcacccca ctcacccacg acctcaccac cgcctacacc     23160
     gcccacaccc accaccaacc accccacccc acacccctac ccctcaccta caccgactac     23220
     acccactggc aacaccaact cctcggcaca ccccaacacc ccacccccac cacccacacc     23280
     caaaccacct actggaccac cacactcacc aacctccccg acaccctccc cctccccacc     23340
     gaccgacccc gacccaccca ccgcacccac cacggggatc gggtcgtgtt ccacatcgga     23400
     cgggacctgc accggtcact atcggcgctc gcgcggcaga acaactcgac gctcttcatg     23460
     gcgatccacg cggtattcgc cgtcctcctc gcccgcctca gcgggagttc cgacatcgtg     23520
     atcggcaccc ccgtcgccgg ccgccccgat ccccggctgg acccattggt cggcatgttc     23580
     gtcaacacac tcgtcctgcg cacgccggtc gacggctccc ggtcgttcac cgaggtactc     23640
     gaccgcacca gggacgtcga tctcggcgcc ttcctgcacg ccgacctgcc cttcgagcgc     23700
     gtcgtcgagg ccgtggatcc ggcgcggtcg acctcccgct caccgctgtt ccaggtgtca     23760
     ctcgaattcg agagcgtcca gcgaccagag atcacactgc cggacctgac ggtcacggtc     23820
     gccgagtaca cgccgcccgt cgtcaaggtc gatctcgaac tggtggtcgc cgagacgttc     23880
     gacgagtccg gtgacccgaa cgggatcgcc gccggattca cctatgccac cgacatcttc     23940
     gacgccgcga ccgtgcaggg cttcgccgat cgtctgaccc gtctcctcgc ggcggtcgtc     24000
     gccgacccgg accacccggt cggagacctc acgctcggcg acgaggacga ggacacctct     24060
     gtctccggac cgcccggcct cccggcgcgg gtgtggcccg acctgctgac cgaggcggtg     24120
     gagcggcacg ccgaccggct ggccgtatcc gacgccggtc gcgcgctcac ctatcgccaa     24180
     ctcggcgaag actccgcgca attcgcccgg ttgctcatcg ctcggggtgc cgtcccagag     24240
     ggtgtcgtcg ccctggcatt gccgcggtcg atcgcgtggg tccgtgccgt gtgggcggtc     24300
     gcccgctcgg gtgcggcgtc ggtacccgtc gacccgacgt atccgctcac ccggatcgcc     24360
     catatgctcg ccgacgccgg cgctgcgctc ggcctcaccg tcgctgggta tcgtgcacag     24420
     ttgcccgaca cggtcgagtg gctggtgctc gatgatcccg acttcgaaac gcaaacgcgg     24480
     cactttcctt ccacgccggt gaccgacgtc gaccgcacag ctccgctgcg cacggacaac     24540
     cccgcctatc tcatctacac gtccgggtcc accggcgccc cgaagggcgt ggtcgtgtcg     24600
     caccggggtc tggcaaacct gttcgagcaa gaacgtcacc acctccacgt cacgcccgat     24660
     gcgcgggtct cgcacctcgc gtcccccagt ttcgacgcgt cgctgttcga gttgacgatg     24720
     gcgttctgtg cgggtgccca ggtcgtgctc gtacccccgc cgacctacgg cgggtcggcc     24780
     ctggcggaca tcctcgccgt tgagcggatc acccacgcgt tcataacccc gaccgcgctc     24840
     gccacgctcg aaccgacggg actcgactcg ctgcgggtcc tcgtcgtcgc cggtgaaccg     24900
     tgcccgaccg acctggcccg gcgatgggca cccggccggc gcatgctcga tgcgtacggt     24960
     cccaccgaga cgacgatctg gtcgcatgtc agtgaaccac tggcaccggc ggaacccgtc     25020
     accatcgggc gccccgtccg cgggttcacc gccgccgtcc tcgacgcccg gctgcatccc     25080
     gttcccccgg gcaccccggg cgagctgtac ctggcagggc ccggtctggc ccgcggctac     25140
     cacgaccgcc cggccacgac ggcgacccat ttcgtcgcct gcccgttcgc cgcccccggg     25200
     tggcggatgt accgcaccgg tgacctggta cgcacccggc ccgacctcac gctcgaacat     25260
     ctcggccgca ccgacttcca gatcaaggtg cgcggattcc gggtcgagcc gggcgaggtc     25320
     gattcgatcc tcgcggcgcg cgcggacatc ggtttcgcgg ccaccgtcgg gcgaaccgga     25380
     ccggacgggg aaccgatact cgtcacctat gtccacggtg cgaccggcgt ggacgtcgac     25440
     gcgagtgcgg tgcgcacggc gttgtccgcg cagcttccgc cgtatctggt gcccgccgcg     25500
     gtcgtcgtac tcgacgaggt gccactgacc ccggccggca agctcgaccg ctcggccctc     25560
     cccgaacccg agttcggtcc ccggcccgac cgattccgtg ccccgtccac ggccgtggag     25620
     cgggccgtcg tcgaggctat cgcggaagtc gtcgacatcg gcgaggaccg cccgatcgga     25680
     gtggaggacg acttcttcgc actcggcggc acgtcactgt ccgcggtccg cgtcgccgcg     25740
     gacctgcagc ggcgactggg ccggccggtg ccgcttcccg cgctcttcct ggaccccact     25800
     cccgcggggc tcgcggcccg cctcgccaca gaagtgcccg ccaccaccga cgaagctctc     25860
     cgggttctcg tgccgctgcg ccgtggtgac cggctcgcac cactattctg cgtccatgcc     25920
     gggatgggcc tggcctgggc gtacaccggg atggtgcgcc atctctcacc ggaccggccc     25980
     gtgtggggac tgcagttgcc ctccctcggc ggcggtcccg agtacgactc gatcgaggac     26040
     ctggcgcacc gatacctcga cgaggtccgt gccgtccagc cggcggggcc gtatcatctg     26100
     ctcggctggt cgctcggcgg tctgatcgcg catgccatgg ccaccgagct gcaggaccgg     26160
     ggtgaggagg tcgcgtccct cgtgctcctg gacagctatg cgggcgaacc gattgcggaa     26220
     cccgacccgt tggacgtcgg agaccttctg cgtgggctgg gggtcgacgt cggacccggc     26280
     gcgaactccc gaccgctcag gtactccgac gccagcgacc gcctccgcga ggcgtacggt     26340
     cccgcagcgg ccatgacggc agaccagctg cggcgcatcg ccgagggata tgaccggtcg     26400
     acccggctag cggcgcgatt cgccccgaga gtctttcgcg gggacgcgct cctgctcatc     26460
     gctgaggacg gtccccacga cggatggggc gactcgatta ccggcaccgt gcaggaagaa     26520
     cacgtcgact gcggacacaa cgacatgatg caaccgaaac cagcacgtgc gatcggcatg     26580
     ctcgtcgaaa actacctatc cgggcggggc aggtag                               26616
//

If you have problems or comments...

PBIL Back to PBIL home page