(data stored in ACNUC7421 zone)

EMBL: CP000431.PE233

CP000431.PE233       Location/Qualifiers
FT   CDS_pept        complement(304139..306706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00233"
FT                   /product="probable non-ribosomal peptide synthetase"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_function: GO:0016788 -
FT                   hydrolase activity, acting on ester bonds; GO_function:
FT                   GO:0016874 - ligase activity; GO_function: GO:0031177 -
FT                   phosphopantetheine binding; GO_function: GO:0048037 -
FT                   cofactor binding; GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92069"
FT                   /db_xref="GOA:Q0SK67"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK67"
FT                   /protein_id="ABG92069.1"
FT                   /translation="MQYLDQVADLVVVADRRDLDTASLTLVCDVLVGVRDADTVTANPV
FT                   GRHRHGRALGGWSAEVLRSSHPLVAAREDMTATVAAAAAVVTGRRDDLSVVTVPVWRVD
FT                   RTRPPRMLGGFENWVDLAFHTSLDRTLAELAEEVKCSRQQEVSWESVKIGEMRSTATGV
FT                   LGTVTRDTGREYLPCQTAPFPLTLVPVADTGGHATLEVYADPVSVDADTAARFGQWVAR
FT                   VVNGLRDPSPRRRRVFGAAVAPVGAGVRAPVSGGRIEDLVVRQAHERPDAVAVTHGRRT
FT                   LTYRALEEQSAWMARGLHDRGVGPGDRVGICVDRSVDLVVTMLAVLRSGAAFVPMDVRH
FT                   PPDRLAYTARDAGVRLVVTELQGEARWAGVPAVTPAELPGSVSGPGEVDWAVGGDGAPA
FT                   YVVYTSGSTGRPKGVVIPHRAVPALMSATATEFAPTPGDTWSMFHSPAFDFSVWEIWGS
FT                   LSTGGRLVIVPYWISRSPVEFHTLLADERVSVLSQTPSAFVLLAAADRDLEPLSALRLV
FT                   VFGGETLDPRVVLPWLDRYPESRCRLVNMFGTTETTVHVTAHTVTRRDALTGSRTVGKP
FT                   LPGWEMAVADEFGDPLPNGLTGEIYVGGAGVALGYLDRAGLTACRFVAAPGGSRWYRTG
FT                   DRGRICDDGTLEHLGRLDTQVQIRGFRVELDEVRSVLLDDPVVTAAAVVPSGRPEDPAG
FT                   IALDAYVVPGGSAAAGGTETVAAIRERAARFLPEHMVPRSITLVDALPLTINGKIDVAR
FT                   LPAPAPRSLPHNVVEPQDGGPLTDAGTAHMLTDIWESVLGVPVSLDDNLFELGGNSLCA
FT                   IKADSMMRRLGLPALPMRELYRHPSIRGICGTLARLYLPRPDR"
     atgcagtacc tcgaccaggt ggccgatctg gtcgtggtcg ccgatcggcg tgatctcgac        60
     actgcctcgc tcacgctcgt gtgtgacgtg ctcgtcggcg tgcgcgacgc cgacacggtg       120
     accgcgaatc ccgttggtcg acatcggcac ggtcgggcac tgggcggatg gagcgcggag       180
     gtactgcgtt cctcccaccc gctggtcgcg gcccgtgagg atatgacggc gacggtggcc       240
     gctgccgccg cggtggtgac cggtaggcgt gacgacctct ccgtggtcac ggttccggtg       300
     tggcgggtcg accggacgcg gccgccccga atgctcggcg gattcgagaa ctgggtcgac       360
     ctggcctttc acacttccct ggaccgcact ctggccgagc tggcggaaga ggtgaaatgc       420
     tcacggcaac aggaggtctc gtgggaatct gtgaagatcg gagaaatgcg cagtacggca       480
     accggggtgc tggggacggt tacacgtgac accggacgtg agtatctccc ctgccagacg       540
     gcgccgtttc cgctgacact cgtgccggtg gccgacaccg gcggacacgc caccctggag       600
     gtctacgccg acccggtgtc tgtggacgcc gacacagcgg cgaggttcgg gcaatgggtc       660
     gcccgagtgg tgaacggact tcgcgatccg tcaccgcgac gacgtcgtgt gttcggtgcg       720
     gcggtggcac cggtgggtgc cggtgtgcga gcgcctgtct ccggcgggag aatcgaggat       780
     ctcgtcgtcc ggcaggctca cgagcgtccc gacgcggtcg cggtgaccca tggccggcgc       840
     acattgactt accgtgcact cgaggagcag tcggcctgga tggcgcgagg tcttcacgat       900
     cggggagtcg gcccggggga ccgggtcgga atctgtgtgg atcggtcggt cgatctcgtc       960
     gtgacgatgc ttgcggtgtt gcgcagcggt gcggcgttcg ttccgatgga cgtgcggcat      1020
     cctccggatc ggctcgcgta cacggcgcgt gatgccggtg tccgattggt cgtgaccgag      1080
     ttgcagggcg aagcccggtg ggccggagta ccggcggtga cgccggcgga gttgccggga      1140
     tcggtatcgg gcccgggtga ggtggattgg gctgtgggag gcgacggcgc ccccgcctac      1200
     gtggtctaca cgtcggggtc gacgggtcgg ccgaaaggcg tggtgattcc gcaccgtgcc      1260
     gtgccggcgc tgatgtcggc caccgcaacc gaattcgcgc cgactcccgg ggacacctgg      1320
     tcgatgttcc attcgcccgc cttcgatttc tcggtgtggg agatctgggg ctcgttgtcg      1380
     accggtggcc gactcgtgat cgtgccgtac tggatctcgc ggtccccagt ggagttccac      1440
     acattgctcg ccgacgaacg cgtctccgtc ctcagtcaaa cgccgtccgc attcgtcctc      1500
     ctggccgcgg ccgaccggga tctcgagccg ctgtccgcgc tccgcctcgt cgtgttcggc      1560
     ggtgagactc tcgacccccg ggtggtactg ccgtggctcg accggtatcc ggaatcacga      1620
     tgccggttgg tgaacatgtt cgggacgacg gaaaccaccg tgcacgtcac cgcgcacacc      1680
     gtgacgcggc gcgacgccct gaccggatcg cgcacggtgg ggaaaccgct acccggctgg      1740
     gagatggcgg tcgcggacga gttcggcgat cctctgccga acggcctgac cggcgagatc      1800
     tacgtcggcg gggccggtgt cgcgctcggg tacctcgacc gtgccggact gactgcctgc      1860
     cgctttgtcg ctgcacccgg cgggtcccgc tggtatcgaa caggcgatcg cggaagaatc      1920
     tgtgacgacg gcactctcga gcatctcggt cgcctcgaca cccaggtcca gattcgcggg      1980
     ttccgtgtgg agctcgacga ggtgcgttcc gtgctcctcg acgatcccgt cgtcacggca      2040
     gcggccgtgg tgccctcggg aaggccggaa gacccggccg gaatcgcgct cgacgcctac      2100
     gtcgtcccgg gcgggtccgc tgcggccggg gggacggaga cggtcgcagc gatacgcgaa      2160
     cgcgcggccc gattcctacc ggaacacatg gtgccccggt cgatcaccct ggtcgacgct      2220
     ctaccgctca ccatcaacgg aaagatcgac gtggcaaggc ttcccgcacc cgcaccgcgg      2280
     tctctgccgc acaatgtcgt cgaaccgcag gacggtggcc ccctcaccga tgcgggaaca      2340
     gcgcacatgc tcaccgacat ctgggagtcg gtgctgggag tcccggtctc gctggacgac      2400
     aacctcttcg agctcggggg gaactcgctg tgcgcgatca aggccgacag catgatgcgg      2460
     cggctcggtc ttcctgccct cccgatgcgg gagctgtacc ggcacccgag catccgcgga      2520
     atctgcggca ctctggcgcg gctctacctg ccccgcccgg ataggtag                   2568
//

If you have problems or comments...

PBIL Back to PBIL home page