(data stored in ACNUC7421 zone)

EMBL: CP000431.PE236

CP000431.PE236       Location/Qualifiers
FT   CDS_pept        308758..309312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK64"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92072.1"
FT                   /translation="MHGTHTDSDMCWVSRPTELDVVGKLVHCLLHHPADCRHTWLRVDP
FT                   QQRNCRRAQRRGRSHGPRSDCEAAELIRVHVVPPTIECMGVAAAARALGRLQYRIARIP
FT                   FHLVDDTVMPAFFDDAAPARLAYEWVLIECDEAAAILFDDDFAATHAQMLRQRSAAVRY
FT                   AIARRQRQALRDTDVVVLERP"
     gtgcatggca cgcacacgga cagcgacatg tgctgggtgt caagaccgac ggaactcgac        60
     gtggtcggga agcttgtcca ctgtctgcta caccacccgg ccgattgtcg gcacacctgg       120
     ttgcgggtcg atcctcagca gcggaattgt cggcgggctc agcggcgggg ccgctcacac       180
     ggaccccggt ccgactgtga ggcagcggaa ttgatacgcg tgcacgtcgt accacctact       240
     atcgagtgca tgggagtcgc agccgcggca cgagcgctcg gccgcctcca gtaccgaatc       300
     gcgcgcattc ccttccacct cgtcgacgac acggtgatgc cggcattctt cgacgacgct       360
     gccccggccc ggctggcgta cgagtgggtg ctgatcgagt gtgacgaggc cgcagcgatt       420
     ctgttcgacg acgacttcgc agccacgcac gcacagatgt tgcggcagcg cagtgccgcc       480
     gtgcgatacg ccatcgcccg ccgacaacgg caggctctcc gcgataccga cgtcgtcgtc       540
     ctcgagcggc cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page