(data stored in ACNUC7421 zone)

EMBL: CP000431.PE238

CP000431.PE238       Location/Qualifiers
FT   CDS_pept        310530..311678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK62"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92074.1"
FT                   /translation="MSRHDGFCASAGPAGLRGAALHRQELRRSGAASAKPGMELCCSSS
FT                   AFEIEAVTGLFHCYVLGGTSLRVGNRSARRPSRNRTLPPRTGGSDNREREFSTFRRRVG
FT                   SRSGPRCAGRSCSPTRADRRTYHGPIGNAPRHLPFRRAALSFMRWQIGRGVLAPLSAMP
FT                   PGSPWWRAVNERLMRDGCEAVARSGGMGGTPSSHTVDLWMLFVADPTARTWYRAHNASI
FT                   ASAYLDHRDLACTESHPERFFLNVVLLRVLYAHALVSAPRLALGRLAPAGPLLGDPRLS
FT                   MTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNIGEMLDYGMIGPRLQQLYEWSADELDEP
FT                   GLLDCICDGSPTYAWSYSDREVWHPASPAATIRAVRRILPAN"
     gtgtctcggc acgatggctt ctgtgcctcg gcaggcccgg ccggtcttcg gggcgcggcc        60
     ctacaccgcc aggagcttcg ccgatccggc gccgcatcgg cgaagcccgg aatggaactg       120
     tgttgtagct cttctgcatt tgaaatcgag gcagtcacag ggctcttcca ctgttacgtc       180
     cttggcggca cctctctccg tgtcggcaac cgatcagcaa ggcggccgag tagaaatcgc       240
     acacttcccc ctcggaccgg cgggtccgac aatagggagc gtgagttctc gacgttccgc       300
     cgcagagtgg gcagtcgatc aggtccacga tgtgcgggac gatcctgcag cccgactcga       360
     gctgatcgcc gtacatatca cggtccgatc ggcaacgcgc cccggcactt gccgttccgc       420
     cgggcggctt tgtcgttcat gcgctggcag atcggtcgcg gcgtgctggc gccgctgagt       480
     gcgatgccgc ccggcagtcc gtggtggcga gcggtcaacg aacggctgat gcgcgacggc       540
     tgcgaggctg tcgcccggag cggcggaatg ggagggacgc cgtcctcgca cacggtcgat       600
     ctgtggatgc ttttcgttgc cgatccgacc gcacgcacct ggtaccgggc ccacaatgcg       660
     agcattgcct ccgcctacct ggaccatcgc gaccttgcct gcaccgagag ccaccccgag       720
     cgcttctttc tcaacgtggt actgctccgt gttctctacg cccatgcctt ggtctcggcg       780
     ccgcgtctgg cgctggggcg gctcgcgccg gccggccccc ttctgggaga tcctcgtctc       840
     tcgatgaccg ggatcttcct gtccctttct cgggtccttc ccgaccgata tcccctcgga       900
     gacgacgtcg cggcgtatgt cgccgctgag cacaacatcg gtgagatgct ggactacggc       960
     atgatcgggc cgcgactgca gcagttgtac gagtggtcgg ccgacgaact cgacgagccg      1020
     gggctactcg actgcatttg cgacggtagt ccgacgtacg cctggtccta ctctgatcgc      1080
     gaggtgtggc atccggcgag cccggccgcc acgattcgcg cagttcggcg gatattgcct      1140
     gcgaactag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page