(data stored in ACNUC7421 zone)

EMBL: CP000431.PE24

CP000431.PE24        Location/Qualifiers
FT   CDS_pept        complement(30746..32179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91860"
FT                   /db_xref="GOA:Q0SKS6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91860.1"
FT                   /translation="MDDNLSFLDAGFLETEDSDPHASLTIGALAIMEGPVPGQDEFRDT
FT                   VAARFATLPHTRDRVHTVPLDFSAPSWSPDPHFDLGHHLRRVALPEPGEEEALFGFVAR
FT                   VMAHRLDRDRPLWECWVVESLTGDRWAILTKIHHCMADGITGTKLFEAMCDEVVAEASG
FT                   TTEADTDTDAVPARTAGTRLASVEGLIRSTIEFLSPMRQLRLVSAALAVPRRLTAAGIG
FT                   VATGLTHLLSEMLTSSTDTSLIGPIGRQRRYCAARVRMHDVREICATYRVTVNDVALAA
FT                   ITTGLRQLLLKRGEHPDPHTVRTLVPVSVRSATEEHSIHNQVSLMLPFLPVDIDDPVAQ
FT                   LVAVHDRLTTHKASKEAEGGKAFTAVAQYGPFMPMAWAVRLATRFPQHSVVAVATNVPG
FT                   PKATRHVMGRTILEIFPYVPIALRLRIGIAILSYSDHLAFGLTGDYDTTPDLADLTDAI
FT                   ERGVLTLLAASRAAAAASE"
     gtggacgaca acttgagctt cctcgacgcg ggtttcctcg agacggagga ctccgaccca        60
     cacgccagcc tgacgatcgg cgctctcgcc atcatggagg gtccggttcc cgggcaagac       120
     gaatttcggg acacggtcgc cgcacgtttc gcgacactcc cgcacacccg agacagggtt       180
     cacacggtcc cactcgactt cagcgcaccc tcgtggtcac cggatccgca tttcgacctc       240
     ggtcatcacc tgcggagggt cgccctcccg gaaccggggg aggaggaggc cctgttcggt       300
     ttcgtcgccc gggtcatggc gcaccgactc gaccgagacc gccccttgtg ggaatgctgg       360
     gtcgtcgaaa gcctcaccgg cgaccgctgg gccatactga ccaagattca ccactgcatg       420
     gcggacggga tcaccggaac gaaactgttc gaggcaatgt gcgacgaagt cgtggccgaa       480
     gcgtcgggaa ccacagaggc cgacaccgac accgacgccg tgccggcacg aaccgccggc       540
     acacgcctcg cgagcgtcga gggcctgatc cgctcgacga tcgagttcct gtccccgatg       600
     cggcaactgc ggctcgtctc ggcggctctg gctgttccgc gcaggctgac agccgccggt       660
     atcggcgtcg caaccggcct cacccacctg ctgtccgaga tgctgacctc ctctacggac       720
     acatcactga tcggaccgat cgggcgccag cgccgctact gcgccgcacg agtccggatg       780
     catgacgtcc gcgaaatctg cgccacgtac cgggtcaccg tcaacgacgt cgcactcgcc       840
     gcgatcacca caggactgcg gcagctgctc ctgaaacggg gcgagcaccc cgacccgcac       900
     acggtccgca cactcgttcc cgtgtccgtc cgctccgcaa ccgaggaaca ttcgatccac       960
     aatcaggtct cgctcatgct gcctttcctg ccggtcgaca tcgacgaccc ggtcgcgcag      1020
     ttggtcgccg tccacgaccg gctcacgacg cacaaggcga gcaaggaagc agaaggcggc      1080
     aaggcgttca ccgcggtcgc ccagtacggg ccgttcatgc cgatggcctg ggcagttcgg      1140
     ctcgccaccc ggttccctca gcacagtgtt gtcgccgtcg caaccaacgt ccccggaccg      1200
     aaggccacac gacacgtgat gggccgcacg atcctggaga tcttcccgta cgtgccgatc      1260
     gcgctgcgac tacggatcgg gatcgcgatc ctcagctaca gcgaccatct cgccttcggt      1320
     ctcaccgggg actacgacac cacacccgac ctcgccgacc tcaccgacgc gatcgaacgc      1380
     ggtgtcctga cactcctcgc cgcctcgcgc gcggctgccg cagcctccga atga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page