(data stored in ACNUC7421 zone)

EMBL: CP000431.PE241

CP000431.PE241       Location/Qualifiers
FT   CDS_pept        313256..314179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00241"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0016563 - transcriptional activator
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92077"
FT                   /db_xref="GOA:Q0SK59"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK59"
FT                   /protein_id="ABG92077.1"
FT                   /translation="MRNSPDLLDEIRAGITVHARPDLQTPIDGLLLSKVTAESAAPEYS
FT                   LTEPLLVIMTQGGKRLLLGDRLYEYRAGQCLVVTASVPVTGHYIDISEGAPSLAMGLVL
FT                   RPAAIAALVLQAPTERWSRGAAGVPAIETGDADVHLLDAAARMLRLLDHPADAPVLAPL
FT                   IEQEILWRLLTGPHGSTIRQIGMADSDLAHVSRAIHWIRDNYSEPMRIDDLARLSSMSA
FT                   SAFHRHFRAVTAMSPLQYQKRIRLQHARSMLVAHPGDVAGVGHHVGYDSPSQFNREYRR
FT                   LFGASPGKDAHGLRGNTALSDTGPLP"
     gtgcgcaact cccccgacct cctggacgag atccgcgccg gaatcacggt ccatgcccgg        60
     ccggatctgc agacgccgat cgatgggctg ttgttgtcga aagtaacggc cgagtcggcg       120
     gcgccggagt attcgctgac cgaaccgctg ctggtgatca tgacccaagg cggcaagcgg       180
     ctcctgctcg gcgaccgact ctacgagtac cgggcggggc aatgtctcgt cgtcaccgcc       240
     agtgtgcctg tcaccggcca ctacatcgac atcagcgagg gcgcgccgtc gttggccatg       300
     ggactggtcc tgcggccggc cgccatcgcc gcactggtgc tgcaggcccc caccgaacgg       360
     tggtcccgcg gcgccgccgg cgtgccggcg atcgagaccg gcgacgcaga tgtccatcta       420
     ctcgacgccg cggcccggat gctgcgactg ctcgatcacc ccgcggacgc gcccgtgctc       480
     gccccgctga tcgagcagga gatcctctgg cggctgctca ccggcccaca tgggagcaca       540
     attcgccaga tcgggatggc cgacagcgac ctggcgcatg tcagccgggc gatccactgg       600
     atccgcgaca actactccga gccgatgcgg atcgacgacc tcgcacggtt gtccagtatg       660
     agtgcatcgg cgtttcaccg gcactttcga gccgtcacgg ccatgagccc cttgcagtat       720
     cagaaacgta tccgactgca acacgcccgc tcgatgctgg tcgcacaccc cggtgacgtc       780
     gccggcgtcg ggcatcacgt cggctacgac agcccctccc agttcaatcg cgaataccgc       840
     cgcctgttcg gcgcctcccc cggcaaagac gctcacggcc tacgcggaaa caccgcgctg       900
     tcggacaccg gccccctgcc ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page