(data stored in ACNUC7421 zone)

EMBL: CP000431.PE242

CP000431.PE242       Location/Qualifiers
FT   CDS_pept        314326..315222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00242"
FT                   /product="possible 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92078"
FT                   /db_xref="GOA:Q0SK58"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK58"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92078.1"
FT                   /translation="MADQYAQQDPTTQYPAPDREHQPELSHPGLTSDMVTAPDHGEKSY
FT                   RGSGRLDGRRALITGADSGIGRAVAIAFAREGADVVVSCLDEEEADARETVRLVEEAGR
FT                   RGVVATGDITSEDHCQYLVDLTVRELGGLDILVNNAAFQMVQTGGIADITTEQFDRVLR
FT                   TNLYALFWLCKKSVAVMEPGSTIVNTSSIQGTNPSPGLLDYATTKAGIIDFTKGLAADV
FT                   AKRGIRVNAVAPGPIWTPLIPATMPADGYRQFGDDVPLGRPGQPAELAPAYVFLASNES
FT                   SYVTGEVLGVTGGTPFT"
     atggccgacc agtacgccca gcaggatccc accacgcagt accccgcccc cgatcgcgaa        60
     caccaaccgg agctatcgca cccgggactg acctccgaca tggtgaccgc cccggatcac       120
     ggcgagaagt cctatcgggg aagcggacgc ctcgacggtc gccgcgccct gatcaccggc       180
     gcggattcgg gcatcgggcg agcggtggcg atcgcgttcg ctcgcgaggg tgccgatgtc       240
     gtggtcagtt gtctggacga ggaggaggcg gatgcacggg agaccgtgcg actggtggaa       300
     gaggccggac gacgaggcgt cgtcgcgacc ggcgacatca cgtcggagga ccactgccag       360
     tatctcgtgg acctgacggt ccgtgaactc ggcggtctcg acatcctcgt caacaacgcg       420
     gcctttcaga tggtgcagac gggtggtatc gccgacatca ccaccgagca gttcgaccgt       480
     gtcctgcgca cgaacctcta cgcgctgttc tggttgtgca agaaatccgt cgcagtcatg       540
     gaacctggat cgacgatcgt gaacacctcg tcgatccagg ggacgaatcc gtctcccggg       600
     cttctcgact acgccaccac gaaggcaggg atcatcgatt tcaccaaggg attggcggcc       660
     gatgtggcga agcggggaat ccgggtcaat gccgttgcac cggggcccat ctggacgccg       720
     ttgatccccg cgacgatgcc cgccgacggt tatcggcagt tcggggacga cgtgcctctg       780
     ggcaggcccg gccagccggc cgaactggca cccgcgtacg tattcctcgc atcgaacgaa       840
     tccagctacg tcaccggaga agtgctcggc gtcaccggcg ggacgccctt cacctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page