(data stored in ACNUC7421 zone)

EMBL: CP000431.PE243

CP000431.PE243       Location/Qualifiers
FT   CDS_pept        complement(315253..315996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00243"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004518 - nuclease activity; GO_function: GO:0005515 -
FT                   protein binding; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0008233 - peptidase activity; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity;
FT                   GO_process: GO:0006289 - nucleotide-excision repair;
FT                   GO_process: GO:0006457 - protein folding; GO_process:
FT                   GO:0006986 - response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92079"
FT                   /db_xref="GOA:Q0SK57"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK57"
FT                   /protein_id="ABG92079.1"
FT                   /translation="MENSDRTTPPIRLDELIDAIKKVHAEAPLEQLTDAVLAAEHLGEL
FT                   ADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRFTP
FT                   RARQVVVVAQNEARAAHNAEILPQHLVLGLLADPEGLGARAIAAQGVKLDSVRHAATAT
FT                   LPPAAEEVPALVPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGVLTGL
FT                   GVDKAAAEENIAANLDAIVAAREKE"
     atggagaatt cggatcgcac gaccccgccc atccgactcg acgagctcat cgacgcgatc        60
     aagaaggtgc acgccgaggc cccgctcgag caactcaccg acgcggtcct cgccgcagaa       120
     cacctcggtg aactggccga ccatctcatc ggccacttcg tcgaccaggc ccgccgctcg       180
     ggggcatcgt ggaccgaaat cggcaagagc atgggcgtca cgaagcaggc cgcgcagaaa       240
     cggttcgtcc ccaaggatcc cgggcaggcc tccgacctcg acccgaatca gggattcagc       300
     cggttcactc cgcgcgcacg acaggtggtg gtggtcgcgc agaacgaggc cagggcggca       360
     cacaacgccg agatcctgcc ccagcatctc gtcctcggac tcctggccga tcccgaaggg       420
     ctcggcgccc gggcgatcgc cgcgcagggc gtgaaactgg attcggtccg gcacgccgcg       480
     accgcgacgc tgccccccgc cgccgaggag gtgcccgcac tcgttccctt cgatgctcag       540
     tcacgcaagg cgctcgaact gacgttccgt gaggcactac gtttggggca caactacatc       600
     ggcaccgagc acatcctgct ggccctgctc gaggtcgagg acggggtcgg tgtgctcacc       660
     ggactgggtg tcgacaaagc tgccgccgag gagaacatcg ccgccaacct cgacgccatc       720
     gtcgccgccc gcgaaaagga gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page