(data stored in ACNUC7421 zone)

EMBL: CP000431.PE244

CP000431.PE244       Location/Qualifiers
FT   CDS_pept        316127..316489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92080"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK56"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92080.1"
FT                   /translation="MHIEKDLVAASATPLVLGILAEGESYGYAILKRVNDLSGGRIQWT
FT                   DGMLYPLLHRLERLGYVSASWGASDSGRRRKHYTITAAGREMLAERRAQWDVVADALSQ
FT                   VWRSVQLPPASAQGWS"
     atgcatatcg agaaagatct ggtggcagcc tcggccactc ccctcgtact cggaattctc        60
     gcggaaggcg agtcgtacgg gtacgccatt ctgaaacgag tcaacgacct gtccggcgga       120
     cggattcagt ggaccgacgg aatgttgtac cccctcctgc atcgcctgga aagattggga       180
     tacgtgtcgg cgtcgtgggg tgcctccgac agcgggcgaa ggcgcaagca ctacacgatc       240
     accgctgcgg gccgggagat gctcgcggaa cgacgcgccc aatgggacgt cgtcgcggac       300
     gctctgagcc aggtgtggcg ctccgtccag ctacccccag cctccgccca aggatggtcg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page