(data stored in ACNUC7421 zone)

EMBL: CP000431.PE245

CP000431.PE245       Location/Qualifiers
FT   CDS_pept        316489..317835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92081"
FT                   /db_xref="GOA:Q0SK55"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK55"
FT                   /protein_id="ABG92081.1"
FT                   /translation="MDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISDLSS
FT                   AGLRTDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLMPAASDGDGTRATRELFVV
FT                   LGLAVGAALSVKAGVATLGEQDLARNLSLFVLPFLAGYFAWKRQVTPRLAAVLLVPFAL
FT                   AAVLLNVFPFASNGSTEVIAAIHAPIALWFAVGLAYVGGQWRSDRRRMDFIRFTGEWVV
FT                   YLTLLALGGGVLIGLTIGAFDALGLSVEWFIEDWVLPFGAAGAVIVAAWLVEAKQNVVE
FT                   NIAPVLTRVFTPLTTLMLLVLLTAFATTGSVVDVDRNLLILMDLILVVVLGLLLYAISA
FT                   RDPYLPPDLFDRLQLVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLLVNL
FT                   TWSAHLILGFLRGHRGFSSTERWQTGYLPVFGMWAALMVGVLPPVFDFV"
     atggataccg acaaggagct cgaatcgcag atcggccagt ggcggggtta cgtcgagcgc        60
     cgtcacgcga tatccgccgc cgacaccgac gagatggaag accatctccg tgatcagatt       120
     tcggacctgt cttccgctgg gctgaggacc gacgaggcct tcctggtcgc ggtcaaacgc       180
     atgggcaacg tcgacgacat ctcccgcgag ttcgctcgcg agcactccga tcgactgtgg       240
     aagcaactcg tcctcatgcc cgccgcgtcg gacggcgacg gcactcgcgc cacacgtgag       300
     ctgttcgtcg ttctcgggct cgccgtcggc gcggcactgt cggtcaaggc aggcgtggcg       360
     acgctcggcg agcaggacct cgcgcgcaac ctcagtctgt tcgttcttcc gttcctcgcc       420
     ggatacttcg cctggaagcg gcaggtgaca ccccgcctcg ccgcggtact gctggtgccg       480
     ttcgcgctgg cggcggtact gctgaacgtc ttcccgttcg catcgaacgg ctccaccgag       540
     gtgatcgcgg cgatccacgc accgatcgcg ctgtggttcg ccgtcggcct agcgtatgtc       600
     ggcggtcagt ggcgatcgga ccgccggcga atggacttca tccgcttcac cggcgaatgg       660
     gtcgtctacc tgaccctcct cgccctcggc ggcggcgtcc tcatcggcct gacgatcggt       720
     gcgttcgacg cactcggcct gagtgtcgag tggttcatcg aggactgggt gctgccgttc       780
     ggggcggcag gcgcggtcat cgtcgccgcg tggctcgtgg aggcgaagca gaatgtggtc       840
     gagaacatcg ccccagtcct cacccgcgtg ttcaccccgc tgacgactct catgctgctg       900
     gtgctgctga cggcattcgc gacgaccggc agcgtcgtcg acgtcgaccg aaacctgttg       960
     atcctcatgg atctcattct cgtcgtcgtc ctgggattgc tgttgtacgc gatttcggcc      1020
     cgtgacccct acctgccgcc cgacctgttc gaccgcctcc aactcgtcct cgtcgtcagt      1080
     gccctcgcgg tcgacctgct gatgctgttc gccatgctga ctcgcatcgc ggaattcggc      1140
     ttcaccccga acaaggtggc ggcactcgga atgaacctgg tcctcctcgt caacctgacg      1200
     tggtcagctc atctcattct cgggttcctg cgcggccacc gcggattcag ctccaccgaa      1260
     cgctggcaga ccggttacct tcccgtcttc ggcatgtggg cggcgttgat ggtcggcgtt      1320
     ctcccaccgg ttttcgactt cgtgtga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page