(data stored in ACNUC7421 zone)

EMBL: CP000431.PE246

CP000431.PE246       Location/Qualifiers
FT   CDS_pept        317859..318542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92082"
FT                   /db_xref="GOA:Q0SK54"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK54"
FT                   /protein_id="ABG92082.1"
FT                   /translation="MFSSDREFTAYGPSYWAMIALFVVGAAVLVRLGRRQTESQARRLG
FT                   RVLAVLTAAIYGATLVHFSIPPTIGGSVPLRLTDLATVAAACALWSRAQWAYALTYYWG
FT                   LVLSTQALISPVLTGPDFPHYQFLAFWAIHLLVVWAAIYLTWGRGMRPRWRSYRFTVLV
FT                   TVVWAAVTFTFNRVAGTNYGFLNRKPATATLLDVLGPWPVYLLTATTLILVVWALMTWP
FT                   WERTR"
     gtgttctcat cggacaggga attcacggcg tacggcccgt cgtactgggc gatgatcgcg        60
     ctgttcgtcg tgggggccgc ggttctggtc cggctcggac gacggcagac cgaatcgcaa       120
     gcccggcgcc tgggccgagt ccttgcggtg ctgacggccg cgatatacgg cgcgacactg       180
     gttcatttct cgattccgcc cacgatcggc ggctcggtac cgctgcgcct gaccgatctc       240
     gcgaccgtag cggcggcctg tgccctgtgg tcccgggcgc agtgggccta cgcgctcacg       300
     tattactggg gactcgtgct gagcacccag gcgttgatct cgcctgttct gaccggtccg       360
     gacttccccc actatcagtt cctcgcgttc tgggcgattc acctgctcgt ggtctgggcg       420
     gccatctatc tgacgtgggg tcgagggatg cggccccggt ggcgcagcta ccggttcacg       480
     gtcctggtca ccgtcgtctg ggcggcagtg accttcacgt tcaaccgcgt cgccggaacc       540
     aactacggct tcctcaacag aaagcctgcc accgcgaccc ttctggacgt tctgggtccc       600
     tggccggtgt acctactgac cgcgacgaca ctgattctcg tcgtgtgggc cctgatgacc       660
     tggccgtggg agcggacacg atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page