(data stored in ACNUC7421 zone)

EMBL: CP000431.PE247

CP000431.PE247       Location/Qualifiers
FT   CDS_pept        318672..319661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00247"
FT                   /product="rod shaping protein, MreB"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0006457
FT                   - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92083"
FT                   /db_xref="GOA:Q0SK53"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK53"
FT                   /protein_id="ABG92083.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKDPHRALAIGT
FT                   EARSLVGRTPIGITPVRPMRDGVIVDLESARAFVTAVIKRVSSARRYGLRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPMEPRAHLVVDIGGGTSEVTA
FT                   ICFGGILSHRSCRVAGDELTNALYQYLRAEHKIVVGELTAERAKLGEPDSAEGQSLVVE
FT                   GRDAVTGRARLVTLETEEIVEALRPTTTGIVQTLTECLDDLPAQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEESFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSA"
     gtgggtggac ttggtatcga tctcggaact gccaacactg tcgtcggaac tcccgacgac        60
     ggcatcgtac tgaacgagcc gtccttcatg ctcgttcgaa cgaaggatcc gcaccgtgct       120
     ctcgcgatcg gcacggaggc gcgaagtctc gtcggccgca ctccaatcgg aatcacgccg       180
     gttcgaccga tgcgtgacgg ggtgatcgtc gacctggagt cggcgcgggc gttcgtcacg       240
     gccgtcatca aacgggtctc ctccgccagg cgatacggtc tgcggcccaa ggccgtcatc       300
     tcggtccccg cgggcgcaac cccgctcgaa cgccgcgcac tgctcgaggt cggccacgag       360
     gccggtctgc ggaaagtggg gttggtaccg gagccggtgg cgggtgcgct cggttgcgga       420
     atcaacccca tggaaccacg cgcacacctc gtcgtcgata tcggcggcgg cacttcggaa       480
     gtcaccgcca tctgtttcgg tggcattctc tctcaccgta gttgccgtgt cgcgggcgac       540
     gaattgacga acgcgctgta ccagtacctg agggcagagc acaagatcgt cgtcggcgaa       600
     ctcaccgccg agcgtgccaa gctgggtgaa cccgacagcg ccgaggggca gtcgctcgtc       660
     gtcgagggcc gcgacgccgt gaccggccgc gcacgcctgg tgacactcga gaccgaggag       720
     atcgtggagg cgttgcggcc gacgacaacc ggaatcgtgc agacattgac ggaatgcctg       780
     gacgacctcc ccgcccaggc gatcggtgac gtgatgtcgg aagggctgct cgtcatcggt       840
     ggcggggcgt tgctccgcgg gctgtcccag ctgctcgaag agtccttcgg attcccggtg       900
     aagaccgccg agcgcccact cacctgcgtc gccgagggcg ctacggcgtg tctggtgcac       960
     cctgaggtgg ttgccgccta cagcgcctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page