(data stored in ACNUC7421 zone)

EMBL: CP000431.PE248

CP000431.PE248       Location/Qualifiers
FT   CDS_pept        complement(319662..322505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00248"
FT                   /product="cell division protein"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0009273 - cell wall biosynthesis (sensu
FT                   Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92084"
FT                   /db_xref="GOA:Q0SK52"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK52"
FT                   /protein_id="ABG92084.1"
FT                   /translation="MHDDKHDDKHESDPWIVGAAIVLVVLGLLNLLSTGKTADAVRHTL
FT                   FAVAGLGIMYVVSRLRMSDLRAFGWAVFTVATVLLAVVPFAGVATKGAQRWLDFGVFTV
FT                   QPSELAKLALVLVPASMLAGGFTLARFVATLAIVGVPIALVALQPDLSTAVVLVATAGF
FT                   MLILARVPLLPLVPLFVLGLASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQAN
FT                   IAIGSGGLWGLARDPMYAVRAEYLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWRA
FT                   ALSARTARTREAALVAAGIGALFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIVGF
FT                   VAIGLVLAVRRDGVARPLWTPDPRRRRRPRGMSAGTLTMTAALVAMSVFAWQLQHDRGA
FT                   EFRAMSDQQMMRCIRLPAERGLILDRNGVPLAVNVAEYAVAVVARMFDEHDDDARNRLA
FT                   AVLARSPDEVADLIDAGGEGESQVEVGRVAPDQARRIVDARLPGVLVVPTGRRQYPYGA
FT                   VLASVLGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYVDPSGHP
FT                   VAAGERVDPVRGHDLRLHLDIEVQNLATDALVEAMRTSKGDLGAAVVMDARNGAVLALA
FT                   SVPGADNNVYGPPADLVALAAQSQTPGPSPLLNNATQTAVPPGSTFKIVVAAANTRYPV
FT                   LSPDAVIDTGAAYTYGGHTFRNWQPMGPHNLLQAIQWSDNVYFYKLGELLGPERMADVA
FT                   GQLGVGRRSGIDLPGEAEGFLGTPENVGSIGATWYPGSTLLMGIGQGTVSATPIQVARW
FT                   TSGIATGAMVTPQLAAAYGSELTPIPTAEPQRLPFADLLGPVRAGMRASASAGTAGQLA
FT                   DLPVPAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPQIQVSVLIRGGGFGSATAGPVVK
FT                   KLLEHYFPRPPAPAPTR"
     atgcacgacg acaagcacga cgacaagcac gaatccgacc cgtggatcgt cggtgcggcg        60
     atcgttctcg tcgtgctcgg ccttctgaat ttgctctcga cagggaagac ggcagacgct       120
     gttcgccaca cgctcttcgc cgttgccggt ctgggcatca tgtatgtggt gtcccgcctg       180
     cggatgagtg atctccgcgc cttcggctgg gcagtgttca ccgtggcgac cgtgttgctg       240
     gcggtcgtac cgttcgcggg ggtcgcgacc aagggtgctc aacgctggct ggacttcggc       300
     gtattcaccg tccagccgtc cgagctggcc aagctcgccc tggttctcgt gcccgcgagc       360
     atgctcgccg gtgggttcac gctggcacga ttcgtcgcga ccttggcgat cgtgggcgta       420
     cccattgcac tcgtcgcact ccaacccgac ctgtcgactg ccgtcgtgct cgtcgcgacg       480
     gcgggattca tgctcatcct cgcccgagtc ccgcttctgc ctctggttcc gctgttcgtg       540
     ctgggtctcg cgtcgcttcc gctggccgtg ctctttctcc gcccctacca gctcgaacgg       600
     gtccacgtgt tcctgtcgag caacgccgac cctgccggcg cgggatgggc cgagctgcaa       660
     gcgaacatcg cgatcggcag cggtggcctg tgggggctgg cgcgcgaccc gatgtacgcg       720
     gtgcgggccg agtatcttcc cgaatcggag cacgatctcg cgttcgccag cctggtgtac       780
     gggtggggtt tgatcgccgg cctggctgtc gtggtggcaa cttcggtcat cgtgtggcgg       840
     gctgcactct ccgcgcgcac ggcgcgcact cgcgaggccg cactcgtcgc ggccgggatc       900
     ggcgcgttgt tcggcatcca cgcgctggtg tcgatcggtc agagtctgtc gctgctgccc       960
     cataccggca tgccgattcc cctcttcagc tacgggggca ccgccgccat cgtcggtttc      1020
     gtcgccatcg gactggtgct cgcggtgcgc cgagacggcg tcgcgcgacc gctgtggacc      1080
     ccggatcccc gacggcggcg ccgcccgcgc ggaatgtcgg cgggcaccct gacgatgacc      1140
     gcggcactcg tcgcgatgtc ggtgttcgcc tggcagttgc aacacgaccg gggtgcggaa      1200
     ttccgggcga tgagcgacca gcagatgatg cggtgcatcc gcctgcccgc agagcgcgga      1260
     ctgatcctcg accgcaacgg tgttcccctg gcggtgaacg tggccgagta cgccgttgcg      1320
     gtggtcgccc ggatgttcga cgagcacgac gacgacgccc ggaaccggtt ggccgcggtg      1380
     ctcgcccggt ctcccgacga ggtcgcggac ctgattgatg ccggtggcga aggcgagtcg      1440
     caggtggaag tcggccgagt cgcgcccgac caggcgcggc gcatcgtgga cgcgcgactt      1500
     cccggtgtcc tcgtggtgcc taccggccgc aggcagtacc cgtacggtgc cgttctcgcc      1560
     tccgtcctcg gacacgtcgg ggtcgccgac gccgacgaca tggaacgctg gccgcatctc      1620
     gcgctcgggt cacgcgtcgg caaggcggga ctcgagaagc agtacgacgc tctgctccgc      1680
     ggcagcgacg gcaaacagtg catgtatgtc gatccgtccg ggcatccggt ggccgccggc      1740
     gaacgggtgg acccggtacg gggccacgat ctgcgcctgc acctcgacat cgaagtgcag      1800
     aacctggcca ccgacgcact cgtggaggcg atgcgcacca gcaagggcga cctcggtgcc      1860
     gcagtcgtga tggacgcgcg gaacggagcc gtgctggccc tcgccagtgt cccgggggcc      1920
     gacaacaacg tctacggacc tccggccgac ctcgtcgccc tcgcggcgca gagtcagacc      1980
     ccggggccga gcccgttgct caacaatgcc acccagaccg ccgtcccccc gggctccacc      2040
     ttcaagatcg tcgtcgcggc ggcgaatacc cgatacccgg tgctgtcgcc ggacgcggtg      2100
     atcgacaccg gcgccgccta cacctacggc ggccacacct tccggaattg gcaaccgatg      2160
     ggcccgcaca atctgctgca ggcgattcag tggtccgaca acgtctactt ctacaagctc      2220
     ggtgaactcc tgggtccgga gaggatggcg gacgtcgcgg gccaactcgg cgtcggcagg      2280
     cggtccggga tcgacctgcc gggcgaggcc gaggggttcc tcggcacccc ggagaacgtc      2340
     ggaagcatcg gggccacctg gtatcccggg tcgacgctgt tgatgggtat cggacagggc      2400
     accgtcagcg cgaccccgat acaggtggcg cgctggacgt cggggatcgc caccggcgcg      2460
     atggtgacgc ctcagctcgc cgcggcgtac gggtcggaac tgacccccat cccgacagcg      2520
     gagccgcagc gtctgccctt cgcggacttg ctcggtcccg tccgggcagg catgcgggcg      2580
     tccgcgtcgg cggggaccgc cgggcaactc gcggacctcc cggtaccggc cggcgcgaag      2640
     accggcacgg cggaggaccc gtcggcgccc ggagaaggac tgaatgcctg gttctccgcg      2700
     gtcgcgcctt tcgacgcccc ccagatccag gtgtcggtgc tgatccgcgg tggtggcttc      2760
     gggtcggcga cggcgggccc cgtggtcaag aaactcctcg agcactactt tccgcgaccg      2820
     cccgccccgg cgccgactcg gtga                                             2844
//

If you have problems or comments...

PBIL Back to PBIL home page