(data stored in ACNUC7421 zone)

EMBL: CP000431.PE249

CP000431.PE249       Location/Qualifiers
FT   CDS_pept        complement(322526..323758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92085"
FT                   /db_xref="GOA:Q0SK51"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK51"
FT                   /protein_id="ABG92085.1"
FT                   /translation="MIEAVTGLLARRTEPADARSDPPEHIDHDARVRGVAVGRLLAVAA
FT                   LTPEQAALLVADALHELELARGEGPYPFRLRNVTVSDAGHLTIECAGSASRRDMNEAVV
FT                   ELLRSIATNCRGSALADRLHESLAETTDLDALVHRVRQAIAPDVDPAEERRKRCQLAGL
FT                   VAATTGRPRPDTEVVGERTDVRDWPYVAAGSTLAPSGWFPPVRNPWHRKRRRPSRRQGA
FT                   LGLIAILILVAAAWMAPRVWSELRRGWDAVLNPVNPSEQNQIRPVSPPPPEPQADQPPS
FT                   ATIDVGRPPPPVDIGAPGSAGPITLVTVTRANGECLPGQACAIRVDIRLDPAAAVGAVT
FT                   WRVNVYDRCSGEVRPTSDVTLPVQPGSQQVYGIVRTDLPPGAALAVAAVTSAPATAASE
FT                   PLLVPAENARC"
     atgatcgaag cagtgacagg gctccttgcg aggagaaccg aacccgccga tgcccgatcc        60
     gacccgcccg aacacatcga tcacgatgca cgtgtccgcg gtgtcgcagt cggaagactc       120
     ctggcggtgg cggcgttgac accagagcag gccgcactac tcgtcgcgga tgcgctccat       180
     gagctcgaac tggcgcgcgg cgaggggccc tacccattcc gcctccggaa cgtgacggtg       240
     tccgatgccg gtcatctcac gatcgagtgc gcgggcagtg cgtcccggcg agacatgaac       300
     gaggcggtgg tcgaacttct ccgaagcatt gcgacgaact gtcgcggttc ggccctggcc       360
     gaccggttgc acgaatcgct cgccgaaaca acagatctgg atgcgttggt gcaccgggtt       420
     cgtcaggcga tcgcacccga tgtcgaccca gccgaggaga gaaggaaacg ctgccaactt       480
     gccgggctcg tcgcggccac cacgggacgg ccgcgtcctg acaccgaggt ggtgggggag       540
     cggacggacg tccgggactg gccatatgtg gcggccggtt ccaccctcgc accgtcaggc       600
     tggtttccgc cggtccggaa tccgtggcat cgcaaaagga gacggccgtc gcggcggcag       660
     ggagcactcg gcctgatcgc gatcctgata ctcgtcgctg cagcgtggat ggctccccgg       720
     gtgtggtcgg agctgcgccg gggatgggac gccgtcctga atcccgtgaa tccctcggag       780
     cagaatcaga ttcggcccgt atcgccgcct ccaccggaac cccaggctga ccagccaccg       840
     tcggcgacga tcgatgtcgg ccggccgccg ccgcccgtcg acatcggtgc ccccggcagt       900
     gcggggccga tcaccctcgt cacggtcacg cgcgccaacg gggagtgcct gcccgggcag       960
     gcgtgcgcga tccgagtcga cattcgcctc gatccggcag cagctgtcgg cgccgtgacc      1020
     tggcgggtga acgtgtacga ccgctgctcc ggcgaggtgc ggcccaccag tgacgtgacg      1080
     ctgcccgttc agccagggtc acaacaggtt tacggcatcg tccggaccga tctgccgccg      1140
     ggcgccgcac tcgccgtcgc ggccgtcacc agcgccccgg cgacggccgc gtccgagccg      1200
     ctgctggtgc ctgccgaaaa cgctcgctgc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page