(data stored in ACNUC7421 zone)

EMBL: CP000431.PE25

CP000431.PE25        Location/Qualifiers
FT   CDS_pept        complement(32241..32774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91861"
FT                   /db_xref="GOA:Q0SKS5"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS5"
FT                   /protein_id="ABG91861.1"
FT                   /translation="MRGSCRLESSVFLLVVAVVLSLVPLAAAFGTATRTRLDDQSRADR
FT                   ATRQQIAAVLLEDANVNLADTTPATGATGQAPARWAVAGTTHTGLVQTAPEAKTGQTIS
FT                   IWIDPAGKIVSAPKTGTENAFEAVGAALALWTMGTTICLTMMIGIRWAGTRYRMSQWDR
FT                   EWRNLGKAPGWPVS"
     atgcggggaa gttgtcgcct cgaatcctcg gtcttcctcc tcgtcgtcgc agtggtgctg        60
     agcttggtcc ccctcgccgc cgccttcgga accgcgaccc gcacccgcct cgacgaccaa       120
     tcccgcgccg accgcgcaac tcggcagcag atcgcggcag tgctcctcga ggacgcaaat       180
     gtcaacctgg cggataccac cccggcgacg ggtgccaccg gccaggcgcc ggcccggtgg       240
     gcggttgccg gtaccacaca caccggtctg gtacagaccg cgccggaagc gaaaacggga       300
     caaacgatca gcatctggat cgacccggcc ggaaagatcg tgtccgcgcc gaagacaggc       360
     accgagaacg cgttcgaggc cgtgggcgcc gcactcgcgt tgtggaccat gggtacgacg       420
     atctgcctca cgatgatgat cggaattcgc tgggcaggaa cgagataccg gatgtcacag       480
     tgggaccgcg agtggcgaaa cctcggaaag gcaccagggt ggccggtcag ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page