(data stored in ACNUC7421 zone)

EMBL: CP000431.PE250

CP000431.PE250       Location/Qualifiers
FT   CDS_pept        complement(323973..325544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92086"
FT                   /db_xref="GOA:Q0SK50"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK50"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92086.1"
FT                   /translation="MGCAGPRPASTAKGMTSTNWTRWLPLAAVAVFVVVLAASGMVPVW
FT                   PGLLHLVALPPLDQFADLRLLLVRTASWPQFLVLLSVVSAVRVMLMAWLLGGLDARRLR
FT                   FAAMFYAAAFGPVLLATLGDATAYAALYSRAFWPAVALVGLLVVILGPVPWQGGVTVRG
FT                   AMARGWRRGLRIEVMVPYCAAVLGLGVLADRAPALTVLLLPVSAAATGLTVWAMDREPV
FT                   TRPVAALAAVLVVVTAASVIFVRTRGYDDPEPAPRQAGSLFLMSGINSRSGQGSIPRAD
FT                   VHRLGYECDQVYYFSYAGPGDGQPQRDSTCPIRSGAPYESADTQRPVEEQVALFAEQTA
FT                   NLQRPLTVAAHSHAAWIAWDAVATGRARVDVLVLVGVFPETPLGFPPPDGDRRGRVFGD
FT                   LLRWAAPVTDVVFFHFDPDTPAARQLLGTAGSAQAILGEPLPGEVRVLSITSAADLPLM
FT                   PHGWRLDVERNGCPVRAAHSSLPTSAAFEDEVIRFLDHRDPPPCPMWRDWGAVVMHAFG
FT                   SPPSGS"
     atgggttgtg caggaccacg accagcgagt acagcgaaag gtatgacgtc gacgaactgg        60
     acgcggtggt tgccgttggc ggccgtcgcg gtgttcgtcg tcgtgctcgc ggcgagcggg       120
     atggttcccg tctggccggg actgctgcac ctggtcgcgc tgccgccgct ggatcagttc       180
     gcggacctgc gacttctgct ggtgcgtacc gcctcgtggc cgcagttcct ggtgctgctc       240
     tccgtggtgt cggccgtgcg ggtcatgctg atggcctggc ttctcggtgg actcgatgcc       300
     cgacgcctcc gcttcgccgc gatgttctac gcggcggcgt tcggcccggt ccttcttgcg       360
     acgctcggtg acgcgaccgc ctacgcggcg ctgtactcgc gggcgttctg gccggcggtg       420
     gcgctggtcg gactgctggt cgtgatcctc ggcccggtcc cgtggcaggg cggggtcacc       480
     gtgcgcgggg cgatggcgcg ggggtggcgc cgcggcctgc ggatcgaggt gatggtgccg       540
     tactgcgcgg cggtcctcgg gctcggcgtt ctggccgacc gggccccggc cctcaccgtg       600
     ctgctcttgc cggtctcggc tgcggcgacg ggactgacgg tgtgggcgat ggaccgtgaa       660
     ccggttaccc ggcccgtcgc ggcgcttgct gccgtgctcg tcgtggtgac ggcggcgtcg       720
     gtgatctttg ttcggacacg aggatatgac gatccggaac ccgcgccccg gcaggccggt       780
     tcgctgttcc tcatgtccgg aatcaattcg cgttcggggc aggggagcat cccccgggcc       840
     gacgtgcacc ggctgggtta cgaatgcgat caggtgtact acttctccta cgccggcccc       900
     ggcgacgggc agccgcagcg tgactcgacg tgtccgatca gatcgggtgc cccgtacgaa       960
     tctgccgaca cccagcgccc cgtcgaggaa caggtcgcgt tgtttgccga acagaccgcg      1020
     aacctgcagc ggccgttgac cgttgccgca cattcccacg ccgcgtggat tgcgtgggac      1080
     gcggttgcca ccgggcgggc gcgggtcgat gtgctggtgc tggtgggcgt ctttccggag      1140
     accccgctcg gctttccacc cccggatggc gatcgacggg gcagggtgtt cggcgacctg      1200
     ttgcggtggg cggcgccggt gaccgacgtc gtcttcttcc acttcgaccc cgacacgccc      1260
     gcggcgcggc aactgctcgg caccgcgggc agcgcacagg ccattctcgg cgagccgctg      1320
     cccggggagg tgcgtgttct gagtatcacc tcggctgccg atcttcccct gatgccgcac      1380
     ggctggcggc tcgacgtcga acgcaatggc tgcccggtcc gcgccgcaca ctcgtcgctg      1440
     cccacctcgg ctgccttcga ggacgaggtg atccggttcc tggaccaccg ggatcctcca      1500
     ccgtgcccga tgtggcggga ctggggtgcg gtcgtgatgc acgcgttcgg gtcaccgccg      1560
     agtgggagct ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page