(data stored in ACNUC7421 zone)

EMBL: CP000431.PE251

CP000431.PE251       Location/Qualifiers
FT   CDS_pept        325703..326185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92087"
FT                   /db_xref="GOA:Q0SK49"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK49"
FT                   /protein_id="ABG92087.1"
FT                   /translation="MERAEAGSRGTLMTFDQFADIFRDVASLGVVREDFHRFDDVVTAK
FT                   LYDLLLVAQESAAAQHRHIVEPTDLPITRGLQENIGLFRELGPGLRVDPIVERLADYPP
FT                   LDGILATETRSGLADITGGLSVALARTFRVVYPELRTVRARTTHWSVISTLVDLYL"
     atggaacgtg cggaggccgg aagccgtggg acgctcatga cgttcgacca gttcgcggac        60
     atcttccggg acgtcgccag tctcggcgtc gtccgggagg actttcaccg attcgacgac       120
     gtcgtcaccg cgaaactcta cgacctgctc ctcgtcgcgc aggagagcgc ggccgcccag       180
     caccggcaca tcgtcgaacc caccgacctg ccgatcaccc gaggcttgca ggagaatatc       240
     ggattgttcc gcgagctcgg acccggcctc cgggtagatc cgatcgtcga acgactggcc       300
     gactacccgc ccctcgacgg catcctcgca accgaaaccc gatcggggct cgccgacatc       360
     accggcggac tcagcgtcgc cctcgcgcgc accttccgcg tcgtctaccc cgagttgagg       420
     accgtgcggg cacggaccac gcactggtcg gtgatcagta ccctcgtcga cctctacctc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page