(data stored in ACNUC7421 zone)

EMBL: CP000431.PE252

CP000431.PE252       Location/Qualifiers
FT   CDS_pept        326374..326796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92088"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK48"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92088.1"
FT                   /translation="MNSTKTRIAAAAATGAALGLGMFMAQSATAAAAPAQSTFPQVVSP
FT                   ESGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTTLYGPAA
FT                   ATVDSQQGATIHQVYYPLEPDDGVISHSLDPDMPWM"
     atgaactcga cgaagacacg catcgccgca gcagccgcaa cgggcgccgc cctcggactg        60
     ggaatgttca tggcccagag cgccactgct gccgccgcac ccgcccagtc gacgttcccg       120
     caagtcgtct cccccgaatc cggactctcc ccgtacaagg tcgaggtcag ggaccgaatc       180
     ggctgcgcaa acgcgtggcc catggtcgcc tgcgacgccc ccgacgaaga cgtgcccccg       240
     caggtgaccc tcgtcgagcc cggcaccacg ctggtcgagc ccggcggcac aactctttac       300
     ggccccgccg ccgcgaccgt tgactcccag cagggtgcca ccatccacca ggtctactac       360
     cccctcgagc ccgacgacgg ggtgatctcc cactcgctcg atcccgacat gccctggatg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page