(data stored in ACNUC7421 zone)

EMBL: CP000431.PE253

CP000431.PE253       Location/Qualifiers
FT   CDS_pept        327004..328536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00253"
FT                   /product="amino acid permease, APC superfamily protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92089"
FT                   /db_xref="GOA:Q0SK47"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK47"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92089.1"
FT                   /translation="MTGLYRDSLPRKFPIEREAAQMTAEDVVGAQIADQECQDCGYKPE
FT                   LKRTLGSFQVFAVSFAFISVAVGIFGTYDDVLRDAGPVGIWLWVIVALGQTLVALVIAQ
FT                   FAARIPLSGSSYQWASRLANPKIGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQP
FT                   DENTARVITLVVVLVQAVLVVFSTRLVGLITSGAVGLELVIVVVLAIGLFAAVAISGEG
FT                   SVGNLTSRGITEGAPNYFAVGGGLMAAMIMGLATLVGFDSAANMAEEAKDPFRSVPRAI
FT                   VGSVVAAAVLGLVFLIALTIAIKDIPRVSASDTPVAAILRDQLGPVMERTLLVAIAFAF
FT                   FGAGMVTLATCSRMVFAMSRDARFPAYRLMRRVNPRTQTPIPATIMIVVVGVVLMAVLP
FT                   GGALLELLTVGTVISAVLYGAIILLYLAVRRRLDRKEGAFDLGRFELPVAIGALLWSAV
FT                   VLFVIVSPSSALTSILIAVGLLLAGGLYFAYLLIFKREVLDTEPGDADVFSH"
     gtgacgggtc tctatcgcga ttcactaccc cgcaagttcc cgatcgaacg tgaggcggcc        60
     cagatgacgg cagaagacgt ggtgggcgcg cagatcgccg atcaagaatg tcaggactgc       120
     ggttacaaac cggagctgaa gcgaacgctg ggctcctttc aggtgttcgc ggtctcgttc       180
     gcgttcatct cggtggcggt cgggatcttc ggcacctacg atgacgtact ccgagacgcc       240
     ggaccggtgg ggatctggct ctgggtgatc gtggcgttgg ggcagaccct ggtggcgctg       300
     gtgatcgccc aattcgcggc ccgcatccca ctcagtggct cctcctatca atgggcctcg       360
     cggctggcca acccgaagat cggctggttg ttcggttggc tcaccttctg ctacctggca       420
     ctcggcgtgg tgacggtcga caacgcgatg gcaagctccg cgctcatgcc gctgttcggc       480
     atgcagcccg acgagaacac ggcgcgcgtg atcacgctcg tggtggtgct tgttcaggcg       540
     gtgctcgtcg tgttctccac gcgcctcgtc gggctgatca cgtcgggcgc ggtcgggctc       600
     gaactggtga tcgtggtggt gctggcgatc gggctcttcg ccgccgtggc gatctcgggc       660
     gagggctcgg tcggcaacct gacctcgcgc ggtatcaccg aaggcgcccc caattacttc       720
     gccgtcggcg gcgggttgat ggctgcgatg atcatggggc tcgccacgct cgtcggcttc       780
     gactccgcgg cgaatatggc tgaggaggcc aaggatccgt ttcgcagcgt cccgcgcgcg       840
     atcgtgggat cggtcgtcgc ggcggctgtg ctgggactgg tgttcctgat cgcgctcacg       900
     attgcgatca aagatatccc ccgggtgagc gccagtgaca ccccggtggc ggcgatcctg       960
     cgcgatcagc tgggtccggt gatggagagg accctcctgg tcgcgatcgc gttcgcattc      1020
     ttcggcgccg ggatggtgac cctcgccacc tgctcgcgga tggtgttcgc gatgtcgcgc      1080
     gacgcgcgtt tccctgccta ccggttgatg cgccgggtca acccgcgcac gcagacaccc      1140
     attccggcga ccatcatgat cgtcgtcgtc ggggtcgtcc ttatggccgt gctgcccggt      1200
     ggcgcactgc tggagttgct cacggtgggg acggtcatct cggcggtcct ctacggcgcg      1260
     ataatcctcc tctatcttgc ggtgcggagg cgactggatc gtaaggaggg cgcgttcgat      1320
     ctcgggcgct tcgagctgcc ggtcgcgatc ggtgcgctgc tgtggtcggc ggtcgtgctg      1380
     ttcgtgatcg tgtcgccctc gagtgcactg acctcgatcc tgattgcggt cgggttgctc      1440
     ctcgcgggcg ggttgtactt cgcgtacctg ttgattttca aacgcgaggt actggacacc      1500
     gagccgggag acgccgatgt cttctcgcac tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page