(data stored in ACNUC7421 zone)

EMBL: CP000431.PE257

CP000431.PE257       Location/Qualifiers
FT   CDS_pept        complement(330973..332238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92093"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK43"
FT                   /protein_id="ABG92093.1"
FT                   /translation="MSVTGVGPVLDTGRAEGAAAALRTTSAVRERARQLLSRAREGDSL
FT                   WFGVDDDALEAAAAEVADVTRARYPDLKIPYHSRWRHFEAGGVDRKAELDARLTALDAP
FT                   GRARAMIDLAVVSVLLDAGAGPDWHYHEVHGGQRFARSEGLGVASWHAFLSGLFSSDAA
FT                   HPLQVDAAGLCGLDTDRLAEVFQAGPSNPLVGLEGRVLLLRRLGEALAAQPEVFGTHGR
FT                   PGGLFDLLVAPQGAATATVAAHDILSQLLTSLSGIWPTGNAIDAEPLGDVWRHDAVAGP
FT                   GLTRGWMPFHKLSQWLSYSLLEPFQWAGVRVVGLDELTGLPEYRNGGLLLDTGVLRLHD
FT                   PAWAAQNWTAGDELVVEWRALTVALLDELAPLVRARLGVDPGEMPLACVLEGGTWAAGR
FT                   ALAQRSRGGLPPLNIVSDGTVF"
     atgagcgtga ccggtgtcgg tcccgttctg gacaccgggc gggccgaggg tgcggccgcg        60
     gctctgcgta ccacgtcggc cgtgcgggag cgcgcgcgac agctgctgtc ccgtgcgcgc       120
     gagggcgatt cactctggtt cggcgtcgac gacgacgcat tggaagcggc cgcggcggag       180
     gtcgccgacg tcacgcgtgc ccgctatccc gacctgaaaa ttccgtacca cagccgctgg       240
     cgccatttcg aagccggcgg cgtggaccgc aaggccgagc tggatgcacg gctgaccgcg       300
     ctggacgcgc cgggccgcgc ccgcgccatg atcgacctgg ccgtggtcag cgtccttctc       360
     gacgcaggtg ccggtcccga ctggcactac cacgaggtgc acggcgggca gcggttcgcc       420
     cgttccgagg gcctgggcgt cgcgagctgg cacgcgttcc tcagcggcct gttctcgagc       480
     gacgcggcgc acccgctgca ggtcgatgcg gccgggctgt gcgggctgga cacggaccgg       540
     ctggccgagg tgttccaggc cggcccatcc aacccgttgg tgggcctcga aggtcgcgtg       600
     ctgctgcttc ggcggctggg cgaggcgctc gccgcgcagc ccgaagtgtt cggcacgcac       660
     ggccggccgg gtggcctgtt cgatctgctg gtcgccccac agggtgccgc cacggcgacg       720
     gtcgccgccc acgacatcct gtcgcagctc ctgacgtcgc tgtcgggcat ctggccgacg       780
     ggcaacgcca tcgacgccga accgttgggc gacgtctggc gccacgacgc ggtggccggt       840
     ccgggcttga cgcggggctg gatgccgttt cacaaactgt cgcagtggct gagttattcg       900
     ttgctggagc ccttccaatg ggcgggcgtt cgggtggtcg ggttggacga gctgaccggc       960
     ctgcccgaat accgcaacgg cggtctgctt ctcgataccg gtgtgctccg cctgcacgat      1020
     ccggcctggg ctgcacaaaa ctggacggcc ggagacgaat tggtggtcga gtggcgcgcg      1080
     ttgacggtag ccctgctgga cgaactggcc ccgctggtgc gcgcacgtct gggcgtggat      1140
     cccggagaga tgccgttggc ctgcgtcttg gagggcggca cctgggcggc gggccgcgcg      1200
     ctggcacagc gctcgcgggg tgggctgccg ccgctgaaca tcgtcagcga cggcacggtc      1260
     ttctag                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page