(data stored in ACNUC7421 zone)

EMBL: CP000431.PE259

CP000431.PE259       Location/Qualifiers
FT   CDS_pept        333624..335081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92095"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK41"
FT                   /protein_id="ABG92095.1"
FT                   /translation="MWRRRRRANADEVHGDRAWDSVAEVTKNRARAVDLRTQIEADDVF
FT                   ARGYALRATVPSSAHESAAVGAGRPDVLDFVEASNRGRLANLIPLRIGRMIASPFAFFR
FT                   GAAGLMAADLADSPVTGLTAQLCGDAHAANFGLYGTPDGHIVMDINDFDETLPGPWEWD
FT                   LKRLAASLVLAGREGGVSENGCIEAAEDAVKSYRRTIRDLAELPFLQSWNALPDKSVLE
FT                   RAKADALLDDFDKAAQKARRNTSEKVAAKWTAHLEDHETGIRRRRFIDDPPVLTHVDRA
FT                   TADAVTDGLELYVDSLRESRRNLIARFAVSDVAFRIVGTGSVGLRSYIALLHGNRDEVL
FT                   VLQLKQARPSALSAYLPVDEPKHEGKRIVHGARLVQAESDILLGWTTIDGLPFIVRQFR
FT                   NLKGDIDPTGLEQDHLDDYGRLAGALLARAHTRSLDPRVLAGYFANDTELDEVIGRYAV
FT                   SYADQTEADHATLVAAVKSGRIAAEPA"
     gtgtggcgaa gacggcggcg agcgaatgct gacgaggtac acggtgacag agcctgggat        60
     agtgtcgccg aggtgacgaa gaatcgagcg cgagccgtcg acctgcgaac ccagatcgag       120
     gcggacgacg tcttcgcgcg gggctacgcg ttgcgagcca ctgtgccgtc gagtgcgcac       180
     gagagcgccg cggtcggcgc gggacggccg gatgtgctcg atttcgtcga ggccagcaat       240
     cgaggaaggc tggctaatct gatcccgctg cgaatcggtc ggatgatcgc ctccccgttc       300
     gctttcttcc gcggcgccgc cggcctgatg gcggccgacc tcgcagactc tccggttacc       360
     ggattgacag cgcagttgtg cggcgacgcg catgcggcca acttcggcct gtacggcaca       420
     ccggacggtc acatcgtcat ggacatcaac gatttcgacg aaaccctccc cggtccgtgg       480
     gagtgggatc tcaaacgcct cgccgcgagc ctggtcctcg ccggacgcga aggcggtgtg       540
     tccgagaacg gctgcatcga ggccgccgaa gacgccgtca aatcgtatcg gcgcaccatt       600
     cgcgatctcg ccgaactgcc attccttcag tcgtggaacg cgctcccgga caagtcggtg       660
     ctcgagcggg ccaaggccga cgctctgctc gacgacttcg acaaggccgc gcagaaggcg       720
     cggcgcaata ccagcgagaa ggtcgcggcg aagtggaccg cccacctcga agatcacgag       780
     accgggatcc gccgacgacg gttcatcgac gacccgccgg tcctcaccca cgtcgatcgc       840
     gcaaccgccg acgccgtgac cgacggtctg gaactgtatg tcgactcact gcgcgagtcc       900
     cgcaggaact tgatcgcccg attcgccgtg tccgacgtcg cgttccggat cgtcggaacc       960
     ggcagcgtgg gtctgcgcag ctatatcgcc ctcctgcacg gtaatcggga cgaggtgctc      1020
     gtacttcaac tgaagcaggc ccggccgtcc gcactatcgg cgtacctacc ggtcgacgag      1080
     ccgaaacacg agggcaagcg gatagtgcac ggcgcccggc tggtgcaggc ggaatcggac      1140
     attctgctgg gctggacgac catcgacggc ctccctttca tcgtgcggca gttccgaaac      1200
     ctcaaagggg acatcgatcc aaccggtctc gagcaagatc atctcgacga ctacggccgg      1260
     ctcgcaggcg ccctgctcgc gcgtgcacac acccgctcgc tcgatccgcg ggtgctcgcc      1320
     ggctacttcg ccaacgacac ggaactggac gaggtgatcg ggcggtatgc cgtcagctac      1380
     gccgatcaaa ccgaagccga ccacgcaaca ctggtcgccg cggtgaaatc cgggcggatc      1440
     gccgccgagc cggcctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page