(data stored in ACNUC7421 zone)

EMBL: CP000431.PE26

CP000431.PE26        Location/Qualifiers
FT   CDS_pept        complement(32906..33760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00026"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91862"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS4"
FT                   /protein_id="ABG91862.1"
FT                   /translation="MVDPAIVVGVDGSGPALDAVRWAAREATVRRAPLLLLSCITYRGT
FT                   EDGPRLAETLHARAERNVAEARETARAGSADADLDIRAEVSHQNAPGSLVDRSAGAEMV
FT                   VLGRRGLGEFTDGLIGSVTSAVVRHAQCPVAVIDGWSRVADGTGPVVVGIDGSPSSARA
FT                   VGLAFEECSLHNAELIALHAWSDQDLSILPVGVEQTAERSVLDAAVAEWCERFPDVSVR
FT                   RTLVRDRPVRHLLEMADEAQMIVVGSRGRGGFPGMTLGSTSAALVHITPCPLLIAGPIR
FT                   PGR"
     atggtcgatc cggcgatcgt tgtgggagtg gacggatccg ggccggcgct ggatgcggtg        60
     cggtgggccg cacgtgaggc gacagtgcgc agggcgccgc tactgttgtt gtcctgcatc       120
     acgtaccgcg gtacggaaga tgggcctcga ctcgccgaaa cgctccacgc ccgagccgag       180
     cggaacgttg ccgaggcacg cgagaccgcc cgagctgggt ccgcagacgc ggacctcgac       240
     attcgggcgg aggtgtcaca tcagaacgcc ccgggatcac tcgtcgaccg atccgccggc       300
     gcagaaatgg tcgtcctcgg caggcgcgga ctcggggagt tcaccgacgg gctgatcggc       360
     tccgtgactt cggccgtggt gcgtcatgcc cagtgcccgg tcgcagtgat cgacggttgg       420
     tcgagagtcg cggacggcac gggacccgtc gtcgtcggca tcgacggatc tccgagcagt       480
     gcacgggccg tcggactggc gttcgaggag tgttccctcc acaacgcgga actgatcgcg       540
     ctgcacgcgt ggtccgacca ggacctgtcg atacttccgg tcggcgtgga gcagaccgcg       600
     gagcggtcgg tgctggacgc cgcggtcgcc gaatggtgtg aacggttccc cgacgtctcg       660
     gtgcgccgaa ctctcgttcg cgaccgtccc gtccgccatc tcctcgagat ggccgacgag       720
     gcccagatga tcgtcgtcgg cagccgcggg cggggcggct tccccgggat gactctcggc       780
     tcgaccagcg cagcgctggt acacatcact ccgtgtcccc ttctgatagc cggaccgatc       840
     cgaccagggc gatga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page