(data stored in ACNUC7421 zone)

EMBL: CP000431.PE260

CP000431.PE260       Location/Qualifiers
FT   CDS_pept        complement(335334..335801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK40"
FT                   /protein_id="ABG92096.1"
FT                   /translation="MRRRGCRVVVFTDERLVRMNRRRWSLRRAVLVVGLAATPLVWCPG
FT                   AATAAPVSAPFQIPRVWASGTFGYCFPACIDVPVAVTGDAPGVVTFHDPALMETVVLWV
FT                   GWTNLSNGTSGVASVTKDKPGVAHTGTGVVTASAMGNLVEYVGARGIFYVP"
     ttgcgtcgga gagggtgccg agttgtcgtt ttcacggacg agaggctcgt gcgaatgaac        60
     cgtcgccgat ggtctcttcg tagggccgtt ctggttgtgg gtctcgccgc gactccactg       120
     gtctggtgtc ctggtgcggc cacagcggcg ccggtgtcgg cgccgtttca gataccccgc       180
     gtgtgggctt cagggacttt cggctattgc ttccccgcct gtatcgacgt cccggttgcg       240
     gttactggcg atgcgccggg ggtcgtgacg tttcatgacc cagcactcat ggaaaccgtc       300
     gtgctgtggg ttggctggac caacctgtcc aacggaacat cgggtgttgc ttccgtgacc       360
     aaagacaagc ctggggttgc ccacaccggt accggggttg ttaccgcctc cgccatgggg       420
     aacctggtcg agtacgtggg agcaagaggc atcttctacg tgccgtag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page